ANKRD13D (ankyrin repeat domain 13D)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 338692
• Gene name: Ankyrin repeat domain 13D
• Gene symbol: ANKRD13D
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: The protein encoded by this gene is a member of the ankyrin repeat domain (ANKRD) 13 family, which currently consists of four proteins containing ubiquitin-interacting motifs. These proteins are integral membrane proteins that bind specifically to Lys-63-

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043351	hsa-miR-331-3p	CLASH	23622248
MIRT040988	hsa-miR-505-3p	CLASH	23622248
MIRT782873	hsa-miR-1343	CLIP-seq
MIRT782874	hsa-miR-15a	CLIP-seq
MIRT782875	hsa-miR-15b	CLIP-seq
MIRT782876	hsa-miR-16	CLIP-seq
MIRT782877	hsa-miR-195	CLIP-seq
MIRT782878	hsa-miR-214	CLIP-seq
MIRT782879	hsa-miR-3619-5p	CLIP-seq
MIRT782880	hsa-miR-424	CLIP-seq
MIRT782881	hsa-miR-4264	CLIP-seq
MIRT782882	hsa-miR-4283	CLIP-seq
MIRT782883	hsa-miR-4291	CLIP-seq
MIRT782884	hsa-miR-4489	CLIP-seq
MIRT782885	hsa-miR-4645-5p	CLIP-seq
MIRT782886	hsa-miR-4673	CLIP-seq
MIRT782887	hsa-miR-4763-5p	CLIP-seq
MIRT782888	hsa-miR-497	CLIP-seq
MIRT782889	hsa-miR-622	CLIP-seq
MIRT782890	hsa-miR-761	CLIP-seq
MIRT782891	hsa-miR-767-3p	CLIP-seq
MIRT782892	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IEA
GO:0002091	Process	Negative regulation of receptor internalization	IMP	22298428
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32814053, 33961781, 34927784
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22298428
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	22298428
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22298428
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0140036	Function	Ubiquitin-modified protein reader activity	IDA	22298428
GO:0140036	Function	Ubiquitin-modified protein reader activity	IEA
GO:0140036	Function	Ubiquitin-modified protein reader activity	IPI	22298428

Other IDs

• MIM: 615126
• HGNC: 27880
• e!Ensembl: ENSG00000172932

Protein

• UniProt ID: Q6ZTN6
• Protein name: Ankyrin repeat domain-containing protein 13D
• Protein function: Ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. Does not bind 'Lys-48'-linked ubiquitin. Positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated E
• PDB: 7RMA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11904	GPCR_chapero_1	68 → 382	GPCR-chaperone	Domain

• Sequence:

  MVQLVLQYRDYQRATQRLAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVSKMCPSDVYRV
  WKRGESLRVDTSLLGFEHMTWQRGRRSFIFKGQEAGALVMEVDHDRQVVHVETLGLTLQE
  PETLLAAMRPSEEHVASRLTSPIVSTHLDTRNVAFERNKCGIWGWRSEKMETVSGYEAKV
  YSATNVELVTRTRTEHLSDQDKSRSKAGKTPFQSFLGMAQQHSSHTGAPVQQAASPTNPT
  AISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSEEHPLSLGDQVTPIIDLMAIS
  NAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPLSSVWVPAPSSAVA
  ASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTV
  WEALTNTRPGARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE
  QLRLALELSSREQEERERRGQQEEEDLQRILQLSLTEH

• Sequence length: 518

Related Genes

No strongly related genes found yet for ANKRD13D.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ANKRD13D.