Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9068
Gene name	Angiopoietin like 1
Gene symbol	ANGPTL1
Synonyms (NCBI Gene)	ANG3ANGPT3ARP1AngYUNQ162dJ595C2.2
Chromosome	1
Chromosome location	1q25.2
Summary	Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The p

103 Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054764	hsa-miR-921	Luciferase reporter assayqRT-PCRWestern blotting	24886719
MIRT781474	hsa-miR-1252	CLIP-seq
MIRT781475	hsa-miR-1298	CLIP-seq
MIRT781476	hsa-miR-3137	CLIP-seq
MIRT781477	hsa-miR-376a	CLIP-seq
MIRT781478	hsa-miR-376b	CLIP-seq
MIRT781479	hsa-miR-4760-3p	CLIP-seq
MIRT781480	hsa-miR-4778-5p	CLIP-seq
MIRT781481	hsa-miR-4795-5p	CLIP-seq
MIRT781482	hsa-miR-544	CLIP-seq
MIRT781483	hsa-miR-659	CLIP-seq
MIRT781484	hsa-miR-664	CLIP-seq
MIRT781485	hsa-miR-9	CLIP-seq
MIRT1930664	hsa-miR-1184	CLIP-seq
MIRT1930665	hsa-miR-1205	CLIP-seq
MIRT1930666	hsa-miR-3158-5p	CLIP-seq
MIRT1930667	hsa-miR-4775	CLIP-seq
MIRT781482	hsa-miR-544	CLIP-seq
MIRT1930668	hsa-miR-590-3p	CLIP-seq
MIRT781475	hsa-miR-1298	CLIP-seq
MIRT781477	hsa-miR-376a	CLIP-seq
MIRT781478	hsa-miR-376b	CLIP-seq
MIRT781479	hsa-miR-4760-3p	CLIP-seq
MIRT2171276	hsa-miR-511	CLIP-seq
MIRT781484	hsa-miR-664	CLIP-seq
MIRT781483	hsa-miR-659	CLIP-seq
MIRT781485	hsa-miR-9	CLIP-seq
MIRT2473939	hsa-miR-1227	CLIP-seq
MIRT2473940	hsa-miR-1269	CLIP-seq
MIRT2473941	hsa-miR-1269b	CLIP-seq
MIRT2473942	hsa-miR-194	CLIP-seq
MIRT2473943	hsa-miR-204	CLIP-seq
MIRT2473944	hsa-miR-211	CLIP-seq
MIRT2473945	hsa-miR-3143	CLIP-seq
MIRT2473946	hsa-miR-3607-3p	CLIP-seq
MIRT2473947	hsa-miR-3646	CLIP-seq
MIRT2473948	hsa-miR-3658	CLIP-seq
MIRT2473949	hsa-miR-3662	CLIP-seq
MIRT2473950	hsa-miR-3672	CLIP-seq
MIRT2473951	hsa-miR-4274	CLIP-seq
MIRT2473952	hsa-miR-4282	CLIP-seq
MIRT2473953	hsa-miR-4480	CLIP-seq
MIRT2473954	hsa-miR-4519	CLIP-seq
MIRT2473955	hsa-miR-4520b-3p	CLIP-seq
MIRT2473956	hsa-miR-4524	CLIP-seq
MIRT2473957	hsa-miR-4529-3p	CLIP-seq
MIRT2473958	hsa-miR-4652-3p	CLIP-seq
MIRT2473959	hsa-miR-4666-5p	CLIP-seq
MIRT2473960	hsa-miR-4677-3p	CLIP-seq
MIRT2473961	hsa-miR-4729	CLIP-seq
MIRT2473962	hsa-miR-4738-3p	CLIP-seq
MIRT2473963	hsa-miR-4749-3p	CLIP-seq
MIRT2473964	hsa-miR-4755-5p	CLIP-seq
MIRT781479	hsa-miR-4760-3p	CLIP-seq
MIRT2473965	hsa-miR-543	CLIP-seq
MIRT2473966	hsa-miR-548ac	CLIP-seq
MIRT2473967	hsa-miR-548ae	CLIP-seq
MIRT2473968	hsa-miR-548aj	CLIP-seq
MIRT2473969	hsa-miR-548am	CLIP-seq
MIRT2473970	hsa-miR-548d-3p	CLIP-seq
MIRT2473971	hsa-miR-548x	CLIP-seq
MIRT2473972	hsa-miR-548z	CLIP-seq
MIRT2473973	hsa-miR-579	CLIP-seq
MIRT2473974	hsa-miR-623	CLIP-seq
MIRT781484	hsa-miR-664	CLIP-seq
MIRT2473939	hsa-miR-1227	CLIP-seq
MIRT2473940	hsa-miR-1269	CLIP-seq
MIRT2473941	hsa-miR-1269b	CLIP-seq
MIRT2473942	hsa-miR-194	CLIP-seq
MIRT2473943	hsa-miR-204	CLIP-seq
MIRT2473944	hsa-miR-211	CLIP-seq
MIRT2473945	hsa-miR-3143	CLIP-seq
MIRT2473946	hsa-miR-3607-3p	CLIP-seq
MIRT2473947	hsa-miR-3646	CLIP-seq
MIRT2473948	hsa-miR-3658	CLIP-seq
MIRT2473949	hsa-miR-3662	CLIP-seq
MIRT2473950	hsa-miR-3672	CLIP-seq
MIRT2473951	hsa-miR-4274	CLIP-seq
MIRT2473952	hsa-miR-4282	CLIP-seq
MIRT2473953	hsa-miR-4480	CLIP-seq
MIRT2473954	hsa-miR-4519	CLIP-seq
MIRT2473955	hsa-miR-4520b-3p	CLIP-seq
MIRT2473956	hsa-miR-4524	CLIP-seq
MIRT2473957	hsa-miR-4529-3p	CLIP-seq
MIRT2473958	hsa-miR-4652-3p	CLIP-seq
MIRT2473959	hsa-miR-4666-5p	CLIP-seq
MIRT2473960	hsa-miR-4677-3p	CLIP-seq
MIRT2473961	hsa-miR-4729	CLIP-seq
MIRT2473962	hsa-miR-4738-3p	CLIP-seq
MIRT2473963	hsa-miR-4749-3p	CLIP-seq
MIRT2473964	hsa-miR-4755-5p	CLIP-seq
MIRT781479	hsa-miR-4760-3p	CLIP-seq
MIRT2473965	hsa-miR-543	CLIP-seq
MIRT2473966	hsa-miR-548ac	CLIP-seq
MIRT2473967	hsa-miR-548ae	CLIP-seq
MIRT2473968	hsa-miR-548aj	CLIP-seq
MIRT2473969	hsa-miR-548am	CLIP-seq
MIRT2473970	hsa-miR-548d-3p	CLIP-seq
MIRT2473971	hsa-miR-548x	CLIP-seq
MIRT2473972	hsa-miR-548z	CLIP-seq
MIRT2473973	hsa-miR-579	CLIP-seq
MIRT2473974	hsa-miR-623	CLIP-seq
MIRT781484	hsa-miR-664	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10025962, 10051567
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10025962
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
603874	489	ENSG00000116194

O95841

Protein name

Angiopoietin-related protein 1 (Angiopoietin-3) (ANG-3) (Angiopoietin-like protein 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	276 → 490	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adrenal gland, placenta, thyroid gland, heart, skeletal muscle and small intestine. Weakly expressed in testis, ovary, colon, pancreas, kidney and stomach. {ECO:0000269|PubMed:10025962}.

Sequence

MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRI
TGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLR
KESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYA
SLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQ
RDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN
SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLS
NQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT
LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSL
RAVQMMIKPID

Sequence length

491

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (35)
Acute leukemia	Leukemia	BEFREE	9539779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15342395, 23434592, 28606130, 28731166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28731166, 34685578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14511611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35692877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14511611, 23379277, 23434592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31738968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17919782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30949864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8782080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28606130, 30610511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	15284220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35832124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22531314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20020177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31786978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23925294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26829602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1321332, 30755815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1321332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	14511611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35275522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20020177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23434592, 28606130, 28731166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14511611, 23379277, 23434592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14511611, 23434592, 30610511		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15940350		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15940350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26976208, 30701025, 31103265, 31213901, 9454907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12097297, 15940350, 30610511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26829602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26829602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	BEFREE	20603325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32410376, 35299682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ANGPTL1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ANGPTL1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ANGPTL1 (see Related Genes above), that are NOT already directly curated for ANGPTL1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ANGPTL1.

ANGPTL1 (angiopoietin like 1)

Bookmark This Gene