AMZ2 (archaelysin family metallopeptidase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51321
• Gene name: Archaelysin family metallopeptidase 2
• Gene symbol: AMZ2
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q24.2
• Summary: The protein encoded by this gene is a zinc metalloprotease that displays some activity against angiotensin-3. The encoded protein is inhibited by the aminopeptidase inhibitor amastatin, as well as by the general inhibitors o-phenanthroline and batimastat.

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039424	hsa-miR-421	CLASH	23622248
MIRT780737	hsa-miR-1244	CLIP-seq
MIRT780738	hsa-miR-199a-3p	CLIP-seq
MIRT780739	hsa-miR-199b-3p	CLIP-seq
MIRT780740	hsa-miR-3129-5p	CLIP-seq
MIRT780741	hsa-miR-3646	CLIP-seq
MIRT780742	hsa-miR-642b	CLIP-seq
MIRT780743	hsa-miR-936	CLIP-seq
MIRT780737	hsa-miR-1244	CLIP-seq
MIRT780738	hsa-miR-199a-3p	CLIP-seq
MIRT780739	hsa-miR-199b-3p	CLIP-seq
MIRT780740	hsa-miR-3129-5p	CLIP-seq
MIRT780741	hsa-miR-3646	CLIP-seq
MIRT780744	hsa-miR-4422	CLIP-seq
MIRT780743	hsa-miR-936	CLIP-seq
MIRT780737	hsa-miR-1244	CLIP-seq
MIRT2171156	hsa-miR-514	CLIP-seq
MIRT2171157	hsa-miR-514b-3p	CLIP-seq
MIRT780742	hsa-miR-642b	CLIP-seq
MIRT780737	hsa-miR-1244	CLIP-seq
MIRT780738	hsa-miR-199a-3p	CLIP-seq
MIRT780739	hsa-miR-199b-3p	CLIP-seq
MIRT780740	hsa-miR-3129-5p	CLIP-seq
MIRT2473797	hsa-miR-34b	CLIP-seq
MIRT780741	hsa-miR-3646	CLIP-seq
MIRT780744	hsa-miR-4422	CLIP-seq
MIRT2473798	hsa-miR-4705	CLIP-seq
MIRT780742	hsa-miR-642b	CLIP-seq
MIRT780743	hsa-miR-936	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005575	Component	Cellular_component	ND
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 615169
• HGNC: 28041
• e!Ensembl: ENSG00000196704

Protein

• UniProt ID: Q86W34
• Protein name: Archaemetzincin-2 (EC 3.4.-.-) (Archeobacterial metalloproteinase-like protein 2)
• Protein function: Probable zinc metalloprotease.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07998	Peptidase_M54	192 → 298	Peptidase family M54	Family

• Tissue specificity: TISSUE SPECIFICITY: Down-regulated in testis from patients with maturation arrest (MA) or Sertoli cell-only syndrome (SCOS). {ECO:0000269|PubMed:17074343}.
• Sequence:

  MQIIRHSEQTLKTALISKNPVLVSQYEKLNAGEQRLMNEAFQPASDLFGPITLHSPSDWI
  TSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIISEEYIKWLTGYCKAYFY
  GLRVKLLEPVPVSVTRCSFRVNENTHNLQIHAGDILKFLKKKKPEDAFCVVGITMIDLYP
  RDSWNFVFGQASLTDGVGIFSFARYGSDFYSMHYKGKVKKLKKTSSSDYSIFDNYYIPEI
  TSVLLLRSCKTLTHEIGHIFGLRHCQWLACLMQGSNHLEEADRRPLNLCPICLHKLQCAV
  GFSIVERYKALVRWIDDESSDTPGATPEHSHEDNGNLPKPVEAFKEWKEWIIKCLAVLQK
  

• Sequence length: 360

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMZ2-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monoclonal B-Cell Lymphocytosis	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for AMZ2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to AMZ2.