ALPK2 (alpha kinase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 115701
• Gene name: Alpha kinase 2
• Gene symbol: ALPK2
• Synonyms (NCBI Gene): HAK
• Chromosome: 18
• Chromosome location: 18q21.31-q21.32

miRNA Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438676	hsa-miR-214-3p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	23929716
MIRT438676	hsa-miR-214-3p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	23929716
MIRT779032	hsa-miR-1269	CLIP-seq
MIRT779033	hsa-miR-1269b	CLIP-seq
MIRT779034	hsa-miR-1288	CLIP-seq
MIRT779035	hsa-miR-186	CLIP-seq
MIRT779036	hsa-miR-3672	CLIP-seq
MIRT779037	hsa-miR-4515	CLIP-seq
MIRT779038	hsa-miR-4740-5p	CLIP-seq
MIRT779039	hsa-miR-4786-5p	CLIP-seq
MIRT779040	hsa-miR-511	CLIP-seq
MIRT779041	hsa-miR-769-5p	CLIP-seq
MIRT2170727	hsa-miR-4676-5p	CLIP-seq
MIRT2170728	hsa-miR-575	CLIP-seq
MIRT2170729	hsa-miR-621	CLIP-seq
MIRT2473422	hsa-miR-1184	CLIP-seq
MIRT2473423	hsa-miR-1205	CLIP-seq
MIRT2473424	hsa-miR-29a	CLIP-seq
MIRT2473425	hsa-miR-29b	CLIP-seq
MIRT2473426	hsa-miR-29c	CLIP-seq
MIRT2473427	hsa-miR-3065-3p	CLIP-seq
MIRT2473428	hsa-miR-3158-5p	CLIP-seq
MIRT2473429	hsa-miR-4639-3p	CLIP-seq
MIRT2473430	hsa-miR-4645-3p	CLIP-seq
MIRT2473431	hsa-miR-4687-3p	CLIP-seq
MIRT2473432	hsa-miR-4733-3p	CLIP-seq
MIRT2473433	hsa-miR-4747-5p	CLIP-seq
MIRT2473434	hsa-miR-4768-5p	CLIP-seq
MIRT779039	hsa-miR-4786-5p	CLIP-seq
MIRT2473435	hsa-miR-490-3p	CLIP-seq
MIRT2473436	hsa-miR-521	CLIP-seq
MIRT2473437	hsa-miR-647	CLIP-seq
MIRT779041	hsa-miR-769-5p	CLIP-seq
MIRT2473438	hsa-miR-942	CLIP-seq
MIRT2473422	hsa-miR-1184	CLIP-seq
MIRT2473423	hsa-miR-1205	CLIP-seq
MIRT2674913	hsa-miR-125a-3p	CLIP-seq
MIRT2674914	hsa-miR-147	CLIP-seq
MIRT2674915	hsa-miR-1914	CLIP-seq
MIRT2674916	hsa-miR-1976	CLIP-seq
MIRT2674917	hsa-miR-19a	CLIP-seq
MIRT2674918	hsa-miR-19b	CLIP-seq
MIRT2674919	hsa-miR-214	CLIP-seq
MIRT2473424	hsa-miR-29a	CLIP-seq
MIRT2473425	hsa-miR-29b	CLIP-seq
MIRT2473426	hsa-miR-29c	CLIP-seq
MIRT2473427	hsa-miR-3065-3p	CLIP-seq
MIRT2473428	hsa-miR-3158-5p	CLIP-seq
MIRT2674920	hsa-miR-3619-5p	CLIP-seq
MIRT2674921	hsa-miR-3665	CLIP-seq
MIRT2674922	hsa-miR-3911	CLIP-seq
MIRT2674923	hsa-miR-4292	CLIP-seq
MIRT2674924	hsa-miR-4308	CLIP-seq
MIRT2674925	hsa-miR-4330	CLIP-seq
MIRT2674926	hsa-miR-4446-5p	CLIP-seq
MIRT2473429	hsa-miR-4639-3p	CLIP-seq
MIRT2473430	hsa-miR-4645-3p	CLIP-seq
MIRT2674927	hsa-miR-4658	CLIP-seq
MIRT2473431	hsa-miR-4687-3p	CLIP-seq
MIRT2674928	hsa-miR-4719	CLIP-seq
MIRT2674929	hsa-miR-4731-3p	CLIP-seq
MIRT2473432	hsa-miR-4733-3p	CLIP-seq
MIRT2473433	hsa-miR-4747-5p	CLIP-seq
MIRT2674930	hsa-miR-4755-5p	CLIP-seq
MIRT2674931	hsa-miR-4757-5p	CLIP-seq
MIRT2674932	hsa-miR-4758-5p	CLIP-seq
MIRT2674933	hsa-miR-4765	CLIP-seq
MIRT2674934	hsa-miR-4766-5p	CLIP-seq
MIRT2473434	hsa-miR-4768-5p	CLIP-seq
MIRT779039	hsa-miR-4786-5p	CLIP-seq
MIRT2674935	hsa-miR-4789-5p	CLIP-seq
MIRT2674936	hsa-miR-4801	CLIP-seq
MIRT2473435	hsa-miR-490-3p	CLIP-seq
MIRT2473436	hsa-miR-521	CLIP-seq
MIRT2674937	hsa-miR-579	CLIP-seq
MIRT2674938	hsa-miR-629	CLIP-seq
MIRT2674939	hsa-miR-644	CLIP-seq
MIRT2473437	hsa-miR-647	CLIP-seq
MIRT2674940	hsa-miR-663b	CLIP-seq
MIRT2674941	hsa-miR-670	CLIP-seq
MIRT2674942	hsa-miR-761	CLIP-seq
MIRT779041	hsa-miR-769-5p	CLIP-seq
MIRT2473438	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003007	Process	Heart morphogenesis	IMP	29888752
GO:0003308	Process	Negative regulation of Wnt signaling pathway involved in heart development	IMP	29888752
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0010468	Process	Regulation of gene expression	IMP	22641666
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IMP	28668886
GO:0016740	Function	Transferase activity	IEA
GO:0030010	Process	Establishment of cell polarity	IMP	28668886
GO:0042981	Process	Regulation of apoptotic process	IMP	22641666
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0055013	Process	Cardiac muscle cell development	IMP	29888752
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1905223	Process	Epicardium morphogenesis	IMP	29888752

Other IDs

• MIM: 619965
• HGNC: 20565
• e!Ensembl: ENSG00000198796

Protein

• UniProt ID: Q86TB3
• Protein name: Alpha-protein kinase 2 (EC 2.7.11.1) (Heart alpha-protein kinase)
• Protein function: Protein kinase that recognizes phosphorylation sites in which the surrounding peptides have an alpha-helical conformation (PubMed:10021370). Regulates cardiac development and cardiomyocyte differentiation by negatively regulating Wnt/beta-cateni
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02816	Alpha_kinase	1926 → 2125	Alpha-kinase family	Family
  PF07679	I-set	12 → 104	Immunoglobulin I-set domain	Domain
  PF07679	I-set	1791 → 1875	Immunoglobulin I-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in developing cardiac tissue and cardiomyocytes (at protein level). {ECO:0000269|PubMed:29888752}.
• Sequence:

  MKDSEGPQRPPLCFLSTLLSQKVPEKSDAVLRCIISGQPKPEVTWYKNGQAIDGSGIISN
  YEFFENQYIHVLHLSCCTKNDAAVYQISAKNSFGMICCSASVEVECSSENPQLSPNLEDD
  RDRGWKHETGTHEEERANQIDEKEHPYKEEESISPGTPRSADSSPSKSNHSLSLQSLGNL
  DISVSSSENPLGVKGTRHTGEAYDPSNTEEIANGLLFLNSSHIYEKQDRCCHKTVHSMAS
  KFTDGDLNNDGPHDEGLRSSQQNPKVQKYISFSLPLSEATAHIYPGDSAVANKQPSPQLS
  SEDSDSDYELCPEITLTYTEEFSDDDLEYLECSDVMTDYSNAVWQRNLLGTEHVFLLESD
  DEEMEFGEHCLGGCEHFLSGMGCGSRVSGDAGPMVATAGFCGHHSQPQEVGVRSSRVSKH
  GPSSPQTGMTLILGPHQDGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFA
  SDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQP
  GMKGNPKKPNANLRESTTEGTLHLCSAKESAEPPLTQSDKRETSHTTAAATGRSSHADAR
  ECAISTQAEQEAKTLQTSTDSVSKEGNTNCKGEGMQVNTLFETSQVPDWSDPPQVQVQET
  VRETISCSQMPAFSEPAGEESPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHE
  EKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARADFREPVAVSVASPE
  PTDTALTLENVCDEPRDREAVCAMECFEAGDQGTCFDTIDSLVGRPVDKYSPQEICSVDT
  ELAEGQNKVSDLCSSNDKTLEVFFQTQVSETSVSTCKSSKDGNSVMSPLFTSTFTLNISH
  TASEGATGENLAKVENSTYPLASTVHAGQEQPSPSNSGGLDETQLLSSENNPLVQFKEGG
  DKSPSPSAADTTATPASYSSIVSFPWEKPTTLTANNECFQATRETEDTSTVTIATEVHPA
  KYLAVSIPEDKHAGGTEERFPRASHEKVSQFPSQVQLDHILSGATIKSTKELLCRAPSVP
  GVPHHVLQLPEGEGFCSNSPLQVDNLSGDKSQTVDRADFRSYEENFQERGSETKQGVQQQ
  SLSQQGSLSAPDFQQSLPTTSAAQEERNLVPTAHSPASSREGAGQRSGWGTRVSVVAETA
  GEEDSQALSNVPSLSDILLEESKEYRPGNWEAGNKLKIITLEASASEIWPPRQLTNSESK
  ASDGGLIIPDKVWAVPDSLKADAVVPELAPSEIAALAHSPEDAESALADSRESHKGEEPT
  ISVHWRSLSSRGFSQPRLLESSVDPVDEKELSVTDSLSAASETGGKENVNNVSQDQEEKQ
  LKMDHTAFFKKFLTCPKILESSVDPIDEISVIEYTRAGKPEPSETTPQGAREGGQSNDGN
  MGHEAEIQPAILQVPCLQGTILSENRISRSQEGSMKQEAEQIQPEEAKTAIWQVLQPSEG
  GERIPSGCSIGQIQESSDGSLGEAEQSKKDKAELISPTSPLSSCLPIMTHASLGVDTHNS
  TGQIHDVPENDIVEPRKRQYVFPVSQKRGTIENERGKPLPSSPDLTRFPCTSSPEGNVTD
  FLISHKMEEPKIEVLQIGETKPPSSSSSSAKTLAFISGERELEKAPKLLQDPCQKGTLGC
  AKKSREREKSLEARAGKSPGTLTAVTGSEEVKRKPEAPGSGHLAEGVKKKILSRVAALRL
  KLEEKENIRKNSAFLKKMPKLETSLSHTEEKQDPKKPSCKREGRAPVLLKKIQAEMFPEH
  SGNVKLSCQFAEIHEDSTICWTKDSKSIAQVQRSAGDNSTVSFAIVQASPKDQGLYYCCI
  KNSYGKVTAEFNLTAEVLKQLSSRQDTKGCEEIEFSQLIFKEDFLHDSYFGGRLRGQIAT
  EELHFGEGVHRKAFRSTVMHGLMPVFKPGHACVLKVHNAIAYGTRNNDELIQRNYKLAAQ
  ECYVQNTARYYAKIYAAEAQPLEGFGEVPEIIPIFLIHRPENNIPYATVEEELIGEFVKY
  SIRDGKEINFLRRESEAGQKCCTFQHWVYQKTSGCLLVTDMQGVGMKLTDVGIATLAKGY
  KGFKGNCSMTFIDQFKALHQCNKYCKMLGLKSLQNNNQKQKQPSIGKSKVQTNSMTIKKA
  GPETPGEKKT

• Sequence length: 2170

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALPK2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	30617256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	40164604	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	21833088, 26920376, 31604244	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	35047847	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	36411363	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (18)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	30617256		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	24325739		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20187983, 35813220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34705617	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28668886		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35813220	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	33705408	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23648141, 24325739, 7537711, 8393423, 9436038		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33705408	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33705408	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10493947, 28668886		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21775055, 23648141, 28668886, 8393423		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23929716		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36856946	Associate	★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	Pubtator	32281771	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20187983	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma of ovary	Undifferentiated ovarian carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ALPK2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ALPK2.