ALKBH7 (alkB homolog 7)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 84266
• Gene name: AlkB homolog 7
• Gene symbol: ALKBH7
• Synonyms (NCBI Gene): ABH7, SPATA11, UNQ6002
• Chromosome: 19
• Chromosome location: 19p13.3

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 35156780
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	23666923
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	ISS
GO:0006974	Process	DNA damage response	IDA	23666923
GO:0006974	Process	DNA damage response	IEA
GO:0010883	Process	Regulation of lipid storage	IEA
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0012501	Process	Programmed cell death	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:1902445	Process	Regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IMP	23666923

Other IDs

• MIM: 613305
• HGNC: 21306
• e!Ensembl: ENSG00000125652

Protein

• UniProt ID: Q9BT30
• Protein name: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial (EC 1.14.11.-) (Alkylated DNA repair protein alkB homolog 7) (Spermatogenesis cell proliferation-related protein) (Spermatogenesis-associated protein 11)
• Protein function: May function as protein hydroxylase; can catalyze auto-hydroxylation at Leu-110 (in vitro), but this activity may be due to the absence of the true substrate (PubMed:25122757). Required to induce programmed necrosis in response to DNA damage cau
• PDB: 4QKB , 4QKD , 4QKF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13532	2OG-FeII_Oxy_2	40 → 203	2OG-Fe(II) oxygenase superfamily	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with highest expression in pancreas, followed by spleen, prostate, ovary and placenta. {ECO:0000269|PubMed:17979886}.
• Sequence:

  MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRR
  YEYDHWDAAIHGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKP
  HVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEIL
  RDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPPPAC

• Sequence length: 221

Related Genes

No strongly related genes found yet for ALKBH7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ALKBH7.