ALKBH6 (alkB homolog 6)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84964
Gene name AlkB homolog 6
Gene symbol ALKBH6
Synonyms (NCBI Gene)
ABH6
Chromosome 19
Chromosome location 19q13.12
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT044584 hsa-miR-320a CLASH 23622248
MIRT437520 hsa-miR-19b-3p Immunoprecipitaion 22382630
MIRT778848 hsa-miR-1225-3p CLIP-seq
MIRT778849 hsa-miR-1273d CLIP-seq
MIRT778850 hsa-miR-1915 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22948820
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 17979886
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
613304 28243 ENSG00000239382
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3KRA9
Protein name Probable RNA/DNA demethylase ALKBH6 (EC 1.14.11.-) (Alkylated DNA repair protein alkB homolog 6) (Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6) (Probable nucleic acid dioxygenase ALKBH6)
Protein function Probable Fe(2+)/2-oxoglutarate-dependent dioxygenase involved in oxidative demethylation of nucleic acids (PubMed:39845104). Binds nucleic acids with a preference for ssDNA or ssRNA to other types of DNAs (PubMed:35120926). May play a role in nu
PDB 7VJS , 7VJV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13532 2OG-FeII_Oxy_2 48 → 224 2OG-Fe(II) oxygenase superfamily Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest expression in testis and pancreas. {ECO:0000269|PubMed:17979886}.
Sequence 
MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQN
WGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLY
YPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRL
LHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK
Sequence length 238
Interactions View interactions

No strongly related genes found yet for ALKBH6.

No additional diseases found yet through genes similar to ALKBH6.