ALKBH2 (alkB homolog 2, alpha-ketoglutarate dependent dioxygenase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 121642
• Gene name: AlkB homolog 2, alpha-ketoglutarate dependent dioxygenase
• Gene symbol: ALKBH2
• Synonyms (NCBI Gene): ABH2
• Chromosome: 12
• Chromosome location: 12q24.11
• Summary: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methy

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	20661249

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000182	Function	RDNA binding	IDA	23972994
GO:0005515	Function	Protein binding	IPI	19736315, 23972994, 26408825, 32296183
GO:0005634	Component	Nucleus	IDA	19736315
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	23972994
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	23972994
GO:0005730	Component	Nucleolus	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006307	Process	DNA alkylation repair	IBA
GO:0006307	Process	DNA alkylation repair	IDA	18432238, 20714506
GO:0006307	Process	DNA alkylation repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008198	Function	Ferrous iron binding	IBA
GO:0008198	Function	Ferrous iron binding	IDA	18432238
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IEA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IBA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IDA	12486230, 16174769, 18432238, 20714506
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051747	Function	Cytosine C-5 DNA demethylase activity	IBA
GO:0051747	Function	Cytosine C-5 DNA demethylase activity	IDA	18432238
GO:0051747	Function	Cytosine C-5 DNA demethylase activity	IEA

Other IDs

• MIM: 610602
• HGNC: 32487
• e!Ensembl: ENSG00000189046

Protein

• UniProt ID: Q6NS38
• Protein name: DNA oxidative demethylase ALKBH2 (EC 1.14.11.33) (Alkylated DNA repair protein alkB homolog 2) (Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2) (Oxy DC1)
• Protein function: Dioxygenase that repairs alkylated nucleic acid bases by direct reversal oxidative dealkylation. Can process both double-stranded (ds) and single-stranded (ss) DNA substrates, with a strong preference for dsDNA (PubMed:12486230, PubMed:12594517,
• PDB: 3BTX , 3BTY , 3BTZ , 3BU0 , 3BUC , 3H8O , 3H8R , 3H8X , 3RZG , 3RZH , 3RZJ , 3RZK , 3RZL , 3RZM , 3S57 , 3S5A , 4MG2 , 4MGT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13532	2OG-FeII_Oxy_2	68 → 254	2OG-Fe(II) oxygenase superfamily	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder. {ECO:0000269|PubMed:12486230, ECO:0000269|PubMed:16174769}.
• Sequence:

  MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHI
  RAEGLDCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGL
  TYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAP
  GSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPV
  RKKVLAPRVNLTFRKILLTKK

• Sequence length: 261

Pathways

Reactome Pathway:

ALKBH2 mediated reversal of alkylation damage

Related Genes

No strongly related genes found yet for ALKBH2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ALKBH2.