ALDH2 (aldehyde dehydrogenase 2 family member)

Gene

• Entrez ID: 217
• Gene name: Aldehyde dehydrogenase 2 family member
• Gene symbol: ALDH2
• Synonyms (NCBI Gene): ALDH-E2, ALDHI, ALDM
• Chromosome: 12
• Chromosome location: 12q24.12
• Summary: This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can b

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs671	G>A	Drug-response, protective, risk-factor	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016754	hsa-miR-335-5p	Microarray	18185580
MIRT023536	hsa-miR-1-3p	Proteomics	18668040
MIRT031438	hsa-miR-16-5p	Proteomics	18668040
MIRT039939	hsa-miR-615-3p	CLASH	23622248
MIRT519128	hsa-miR-1245a	PAR-CLIP	23446348
MIRT519127	hsa-miR-8079	PAR-CLIP	23446348
MIRT519126	hsa-miR-4638-5p	PAR-CLIP	23446348
MIRT519125	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT519124	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT519123	hsa-miR-4765	PAR-CLIP	23446348
MIRT519122	hsa-miR-640	PAR-CLIP	23446348
MIRT519128	hsa-miR-1245a	PAR-CLIP	23446348
MIRT519127	hsa-miR-8079	PAR-CLIP	23446348
MIRT519126	hsa-miR-4638-5p	PAR-CLIP	23446348
MIRT519125	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT519124	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT519123	hsa-miR-4765	PAR-CLIP	23446348
MIRT519122	hsa-miR-640	PAR-CLIP	23446348
MIRT777131	hsa-miR-30a	CLIP-seq
MIRT777132	hsa-miR-30b	CLIP-seq
MIRT777133	hsa-miR-30c	CLIP-seq
MIRT777134	hsa-miR-30d	CLIP-seq
MIRT777135	hsa-miR-30e	CLIP-seq
MIRT777136	hsa-miR-3689a-5p	CLIP-seq
MIRT777137	hsa-miR-3689b	CLIP-seq
MIRT777138	hsa-miR-3689e	CLIP-seq
MIRT777139	hsa-miR-3689f	CLIP-seq
MIRT777140	hsa-miR-4274	CLIP-seq
MIRT777141	hsa-miR-4423-5p	CLIP-seq
MIRT777142	hsa-miR-4519	CLIP-seq
MIRT2170127	hsa-miR-1185	CLIP-seq
MIRT2170128	hsa-miR-3065-3p	CLIP-seq
MIRT2170129	hsa-miR-3140-5p	CLIP-seq
MIRT2170130	hsa-miR-330-3p	CLIP-seq
MIRT2170131	hsa-miR-3679-5p	CLIP-seq
MIRT777136	hsa-miR-3689a-5p	CLIP-seq
MIRT777137	hsa-miR-3689b	CLIP-seq
MIRT777138	hsa-miR-3689e	CLIP-seq
MIRT777139	hsa-miR-3689f	CLIP-seq
MIRT2170132	hsa-miR-3919	CLIP-seq
MIRT2170133	hsa-miR-3942-3p	CLIP-seq
MIRT777140	hsa-miR-4274	CLIP-seq
MIRT2170134	hsa-miR-4282	CLIP-seq
MIRT2170135	hsa-miR-4291	CLIP-seq
MIRT2170136	hsa-miR-4326	CLIP-seq
MIRT777141	hsa-miR-4423-5p	CLIP-seq
MIRT2170137	hsa-miR-4476	CLIP-seq
MIRT777142	hsa-miR-4519	CLIP-seq
MIRT2170138	hsa-miR-4753-3p	CLIP-seq
MIRT2170139	hsa-miR-4756-3p	CLIP-seq
MIRT2170140	hsa-miR-4766-5p	CLIP-seq
MIRT2170141	hsa-miR-4768-5p	CLIP-seq
MIRT2170142	hsa-miR-4793-5p	CLIP-seq
MIRT2170143	hsa-miR-513a-3p	CLIP-seq
MIRT2170144	hsa-miR-520d-5p	CLIP-seq
MIRT2170145	hsa-miR-524-5p	CLIP-seq
MIRT2170146	hsa-miR-548c-3p	CLIP-seq
MIRT2170147	hsa-miR-621	CLIP-seq
MIRT2384067	hsa-miR-578	CLIP-seq
MIRT2170128	hsa-miR-3065-3p	CLIP-seq
MIRT2473006	hsa-miR-3148	CLIP-seq
MIRT2473007	hsa-miR-3674	CLIP-seq
MIRT2170133	hsa-miR-3942-3p	CLIP-seq
MIRT2170134	hsa-miR-4282	CLIP-seq
MIRT2170135	hsa-miR-4291	CLIP-seq
MIRT2473008	hsa-miR-4496	CLIP-seq
MIRT2170138	hsa-miR-4753-3p	CLIP-seq
MIRT2170141	hsa-miR-4768-5p	CLIP-seq
MIRT2170143	hsa-miR-513a-3p	CLIP-seq
MIRT2170128	hsa-miR-3065-3p	CLIP-seq
MIRT2473006	hsa-miR-3148	CLIP-seq
MIRT2473007	hsa-miR-3674	CLIP-seq
MIRT2170133	hsa-miR-3942-3p	CLIP-seq
MIRT2170134	hsa-miR-4282	CLIP-seq
MIRT2170135	hsa-miR-4291	CLIP-seq
MIRT2473008	hsa-miR-4496	CLIP-seq
MIRT2170138	hsa-miR-4753-3p	CLIP-seq
MIRT2170141	hsa-miR-4768-5p	CLIP-seq
MIRT2170143	hsa-miR-513a-3p	CLIP-seq
MIRT2384067	hsa-miR-578	CLIP-seq
MIRT2674900	hsa-miR-628-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IBA
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IDA	4015840, 19506075, 20062057, 27521998
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IEA
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	TAS	1306115
GO:0004030	Function	Aldehyde dehydrogenase [NAD(P)+] activity	TAS	8903321
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	8903321
GO:0006066	Process	Alcohol metabolic process	TAS	1306115
GO:0006067	Process	Ethanol metabolic process	IBA
GO:0006068	Process	Ethanol catabolic process	IEA
GO:0008957	Function	Phenylacetaldehyde dehydrogenase (NAD+) activity	ISS
GO:0009055	Function	Electron transfer activity	TAS	8903321
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0018937	Process	Nitroglycerin metabolic process	IDA	19506075
GO:0046185	Process	Aldehyde catabolic process	IBA
GO:0046185	Process	Aldehyde catabolic process	IDA	20062057, 27521998
GO:0051287	Function	NAD binding	ISS	12693930
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0106435	Function	Carboxylesterase activity	IDA	19506075
GO:0110095	Process	Cellular detoxification of aldehyde	IBA
GO:1903179	Process	Regulation of dopamine biosynthetic process	IEA
GO:1903179	Process	Regulation of dopamine biosynthetic process	ISS
GO:1905627	Process	Regulation of serotonin biosynthetic process	IEA
GO:1905627	Process	Regulation of serotonin biosynthetic process	ISS

Other IDs

• MIM: 100650
• HGNC: 404
• e!Ensembl: ENSG00000111275

Protein

• UniProt ID: P05091
• Protein name: Aldehyde dehydrogenase, mitochondrial (EC 1.2.1.3) (ALDH class 2) (ALDH-E2) (ALDHI)
• Protein function: Required for clearance of cellular formaldehyde, a cytotoxic and carcinogenic metabolite that induces DNA damage.
• PDB: 1CW3, 1NZW, 1NZX, 1NZZ, 1O00, 1O01, 1O02, 1O04, 1O05, 1ZUM, 2ONM, 2ONN, 2ONO, 2ONP, 2VLE, 3INJ, 3INL, 3N80, 3N81, 3N82, 3N83, 3SZ9, 4FQF, 4FR8, 4KWF, 4KWG, 5L13, 8DR9, 8SHS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00171	Aldedh	45 → 508	Aldehyde dehydrogenase family	Family

• Sequence:

  MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
  TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
  ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
  QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
  FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
  DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
  QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
  VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
  PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS

• Sequence length: 517

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alcohol dependence	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alcohol sensitivity, acute	drug response; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALDH2-related disorder	Benign; drug response; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMED SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMED syndrome, digenic	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLICATIONS OF DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES COMPLICATIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER, ALCOHOL-RELATED, SUSCEPTIBILITY TO	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ethanol response - Toxicity	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NITROGLYCERIN, POOR RESPONSE TO	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to hangover	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WERNICKE-KORSAKOFF SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	21958412, 29441687		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	16273622, 31784085		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17559142		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31071657		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16108833		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16108833		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16108833, 21517275		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	12173598, 29156373, 29779728		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	26917006		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19456322, 27808372, 29425204	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10873585, 15126281, 18201725, 26491656		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	16873963		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	39726306	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	27377053	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Macrocytic	Macrocytic anemia	Pubtator	28158658	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	BEFREE	24588059, 28158658		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	10503603	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	17984618	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	16385179, 19302089, 21070510		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24567230, 25543168		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	37314537	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23835015, 24567230, 25430946, 25543168, 29425204		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	29425204	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	37822152	Inhibit	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	27650066		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	30745502		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14597338, 17785925, 27270535, 28858301, 30315930, 30375985, 30507608, 30885430, 31368106		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	37355582	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	31289104		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	11506308, 9600491		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11506308	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	11692094, 20205700, 28049208, 28431562, 7695791, 9600491		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	14597338, 17785925, 27270535, 28858301, 30315930, 30375985, 30507608, 30885430, 31368106		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27270535	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30507608, 36411700	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27927211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	27927211, 34827557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy of testis	Testicular atrophy	BEFREE	11410735		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20166940		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	20166940		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Binge Drinking	Binge drinking	Pubtator	22155604, 36028843	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20577142, 22564712, 25430946, 28778129		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20577142, 22564712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	29425204	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	20577142, 26033520		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	20577142, 22564712, 23835015, 26033520, 29425204		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26992901, 31204364		★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	24037726, 27377053, 39726306	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	8659684		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25253673	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12563175, 19667493, 31066241		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31066241, 32300124, 36200595, 37943872, 38310106	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30850364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35102643	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	8640660		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21672255	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12759747, 18439068, 29582627, 29600553, 35855852, 35877121, 38521503, 9575688	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37335078	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26992901, 31204364		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17559142, 18798003, 20093384, 31071657		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18322963, 18429959, 27038040, 29423536, 34010294, 34022841, 36289279, 37395022	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29247577		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	20467232, 27153870	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	24434637, 30092566		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	21664374, 27624556, 28160209, 29506687		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	24434637		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11391053, 20558439, 21372407, 21664374, 22870576, 23243119, 24382882, 25313998, 26142243, 26491656, 27270535, 27633387, 29535452, 30038465, 30375985, 30507608, 30801261, 30846829, 31368097		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27270535, 29441687, 30507608, 33276716, 33349921	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	17984618	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	14597338, 17984618		★☆☆☆☆ Found in Text Mining only
Carotid Intimal Medial Thickness 1	Carotid intima-media thickness	Pubtator	27270535	Associate	★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	29463997		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	8659684		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	32107439	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25313998, 26142243, 28939800, 31368105		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32481290, 34257742, 40026415, 40304040	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	40603063	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22155604, 23689279, 26708676, 27486170, 29742731, 31368105		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASDB_DG	23041239		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	23041239		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	33651448	Associate	★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	CTD_human_DG	30721697		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18974607		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25084704, 25978981		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12915519, 15519646, 17454860, 1937384, 27118149, 31279903, 7904979		★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29463997		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	25759460, 27904031		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27453488, 29425204, 34257742, 36200595, 40603063	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29401634		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27453488	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20590827		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10470282, 11059519, 11391063, 12433710, 15780035, 16332725, 17517051, 18763293, 19706845, 23149980, 24282520, 24558407, 25573590, 26804999, 27706553, 27706775, 28881356		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16332725		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10470282, 15780035, 18763293, 19456322, 22901167, 24282520, 25573590, 27706775, 33421985, 36426922, 36923554	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16332725, 18763293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16332725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33421985	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conduct Disorder	Conduct Disorder	BEFREE	15122947, 17960296		★☆☆☆☆ Found in Text Mining only
Congenital Bone Marrow Failure Syndromes	Congenital bone marrow failure syndrome	Pubtator	33512438	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	21664374, 23354068, 29535452, 30946956		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	22507973, 31250045		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	30629674	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24067347, 25237043, 27624556, 27742538, 28858301, 29446730, 29885625, 31668970		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	27904031, 32009064	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17984618, 20417517, 23243119, 23685282, 23697560, 24067347, 24333098, 25807426, 26000808, 26782498, 26995653, 28858301, 29278292, 29574217, 29742731, 29960587, 30261890, 30853183		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12119207, 19876063, 20417517, 21971053, 23685282, 23697560, 24067347, 24333098, 25047496, 25253673, 25263942, 25448285, 26000808, 26782498, 26946290, 26995653, 27191745, 28858301, 29278292, 29574217, 29742731, 29877297, 29960587, 30261890, 30853183, 31345174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	21971053, 25047496, 25253673, 26946290, 29960587, 30261890, 31345174	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	27153870, 31368101		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25591559, 25803854, 29742731	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20417517, 23685282, 23697560, 24067347, 24333098, 25803854, 26000808, 26782498, 26995653, 27191745, 28858301, 29278292, 29574217, 29742731, 29960587, 30261890, 30846829, 30853183		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21971053		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21971053		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	28858301		★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	27153870	Associate	★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	9529352	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15123334, 16250071, 29401634		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25543168		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26599441, 37314537	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Occupational	Dermatitis	CTD_human_DG	16758956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	15318096, 15563966, 20700531, 26542604, 27488451, 29401634, 29677191, 31345174, 8877297, 8941476		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	26599441	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15318096, 15563966, 15679538, 20700531, 25263942, 26542604, 27488451, 29128638, 29401634, 29677191, 30038465, 31345174, 8877297, 8941476		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17984618, 20700531, 22155604, 26284938, 31345174, 33276716, 33349921, 33651448, 36050775, 9575688	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24028448, 33651448, 40304040	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12706323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15318096, 19876063, 26599441, 29401634, 29677191, 8877297, 8941476		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15318096		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24028448, 28208752		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	24028448	Associate	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	21437268, 37871625	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25263942, 29960587		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	29960587	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34195683, 34670872	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10235272, 10591585, 10737710, 11238183, 11375898, 12168074, 12198369, 12213289, 12419833, 12672787, 12949054, 14506399, 14652286, 15970497, 16103445, 16127737, 16235983, 16273622, 16365683, 16499490, 16614111, 17036331, 17674367, 17963305, 19452585, 19456322, 19698717, 20010786, 20632450, 20806441, 21157980, 21601984, 21672255, 22292652, 22320964, 22458712, 22703580, 22930414, 23134043, 24588059, 25680115, 25831092, 28253921, 28422823, 28464297, 29707772, 30921184, 31801381, 8640660, 8850269, 8903472, 9451664, 9641490, 9744533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10235272, 10591585, 10737710, 11238183, 11375898, 12168074, 12198369, 12213289, 12419833, 12672787, 12949054, 14506399, 14652286, 15970497, 16103445, 16127737, 16235983, 16273622, 16365683, 16499490, 16614111, 17036331, 17674367, 17963305, 19452585, 19456322, 19698717, 20010786, 20632450, 20806441, 21157980, 21601984, 21672255, 22292652, 22320964, 22458712, 22703580, 22930414, 23134043, 24588059, 25680115, 25831092, 28253921, 28422823, 28464297, 29707772, 30921184, 31801381, 8850269, 8903472, 9451664, 9641490, 9744533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12198369, 14506399, 17036331, 17963305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16127737, 16235983, 16273622, 17963305, 19452585, 19456322, 19472401, 20518787, 20632450, 21672255, 22292652, 22703580, 22930414, 23134043, 26862830, 28158658, 28464297, 29096698, 29423536, 29707772, 32662535, 33132654, 33750341, 35048370, 35670037, 35717470, 36345163, 40156023	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASCAT_DG	19698717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	20833657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	8850269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10896918, 16127737, 16639733, 18322963, 18429959, 19472401, 20128036, 20632450, 21672255, 21926110, 22292652, 23667679, 26873401, 27038040, 28464297, 30639619, 31957322, 33132654, 33826001, 34010294, 36070895, 37943872	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20128036	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21926110	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	17785925, 21476199, 22551939, 26691593, 27270535, 28472173, 28613083		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	21476199, 27270535	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24037726, 24382882, 27377053, 27650066, 30368588		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	24037726, 32487094, 33512438, 36345163, 39726306	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24037726, 24382882, 27650066, 30368588		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	14506613, 25392542, 25457208, 29063269, 30131474		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29718361		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	10235286		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17659824, 29799157, 31279903		★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	28228507	Associate	★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	28228507		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	31209184	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	19396661, 25427912		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33060820	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	33060820	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	27181629, 28566767, 28642574, 33858492	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	GWASCAT_DG	31289104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10235272, 10896918, 14693654, 15714130, 18425322, 19124505, 20590827, 22500060, 24719202, 28253921, 28851901, 30977906		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	10896918, 31957322, 33132654	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	21664374, 31368103		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28578603, 38177014	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24067347, 25237043, 27624556, 27742538, 28858301, 29885625, 31668970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	38177014	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Diseases	Hematologic disease	Pubtator	39726306	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	19174578		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	19174578		★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	21940137		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35877121	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11024579, 25263942, 29128638, 29401634		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10803771		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11510748, 22155604, 22839215, 23615284, 26318866, 27270535, 28562329, 28894224, 32141245, 32843694, 32987175, 33276716, 33349921, 34260573, 35346052, 9575688	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	38177014	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11510748, 12484509, 18318597, 22155604, 22551939, 22839215, 23111423, 23550892, 23615284, 25263942, 26318866, 27270535, 27486170, 27742538, 27927211, 28894224, 29323248, 30846829, 31361523, 31510791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17785925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	15936302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	Hypotension	Pubtator	28578603	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28030785, 31250045		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15123334, 16250071, 27453488, 29024570, 29401634, 29425204		★☆☆☆☆ Found in Text Mining only
Industrial Dermatosis	Industrial Dermatosis	CTD_human_DG	16758956		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	39726306	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	30166580	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26000808, 27486170, 29767275, 30077765, 31114208		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26708676		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	26542604		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18974607	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	18974607		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28841898	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	36050775	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33253299, 33893150, 37761947, 39726306	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	26917006, 28158658		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	29189260		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10737710, 12495467, 12759747, 12940444, 16187278, 18439068, 22004425, 22231434, 25778454, 26150517, 26827895, 28027570, 28238542, 29600553, 29765251, 30720105, 31279903, 31637215, 31737110, 9575688		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16187278, 18439068		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12915519, 12940444, 15519646, 16273622, 17454860, 17659824, 1937384, 27118149, 29509552, 31279903, 7904979		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	11748356, 16273622, 34033144, 37378938	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	11748356, 16273622, 21895718, 25778454, 26042511, 27189280, 29799157, 29968299, 8974324		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	26599441	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	19456322, 29582627	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	22155604, 29582627	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35048370	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	7695791		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17559142, 18798003		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17559142, 22079344, 30088263, 35477569, 37395022	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31071657		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35013309	Associate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	26917006		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10235272, 10896918, 14693654, 15714130, 18425322, 19124505, 20590827, 22500060, 24719202, 28253921, 28851901, 30977906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12563175, 19667493, 31066241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10235272, 10591585, 10737710, 11238183, 11375898, 12168074, 12198369, 12213289, 12419833, 12672787, 12949054, 14506399, 14652286, 15970497, 16103445, 16127737, 16235983, 16273622, 16365683, 16499490, 16614111, 17036331, 17674367, 17963305, 18254707, 19452585, 19456322, 19698717, 20010786, 20632450, 20806441, 21157980, 21601984, 21672255, 22292652, 22320964, 22458712, 22703580, 22930414, 23134043, 24588059, 25680115, 25831092, 28253921, 28257851, 28422823, 28464297, 29136221, 29707772, 30921184, 31801381, 8850269, 8903472, 9451664, 9641490, 9744533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	GWASDB_DG	19698717, 21642993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	8850269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26150517		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28841898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25427900, 26804999, 30088263, 31279903, 31580537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17559142, 18798003, 20093384, 31071657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10521794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	29206831		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29247577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15714130, 19068087, 20590827, 21441790		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11238183, 15929164, 17631643, 21133627, 21507992, 22144473, 23455379, 24011243, 24633362, 25427912, 25524923, 28002588, 28036260, 29166882, 29254255, 29509552, 29616362, 30202044, 9744533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26992901, 31204364		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10591585, 10889918, 11238183, 11391063, 12168074, 12672787, 14652286, 15542751, 16499490, 16614111, 16759795, 17033202, 17040107, 17543846, 18616675, 19185835, 19449376, 19874182, 20224884, 20477767, 20518787, 20652463, 21401890, 21609791, 21895720, 21917409, 23134043, 24382882, 25680115, 25831092, 26804999, 26862830, 27087413, 27224914, 27714678, 28253921, 28257851, 28916862, 29195668, 30088263, 30921184, 31071657, 31279903, 31368096, 31368107, 31402483, 31801381, 8640660, 8903472, 9419411, 9641490, 9744533		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20590827		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31649957		★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	16082583, 16805853		★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	CTD_human_DG	30721697		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25543168		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25411394, 25543168		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	36523602	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26174136, 28371326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28371326		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	28371326		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31209184	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	8941476		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	20477771		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	39726306	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10503603, 12452318, 20467232, 26599441, 27153870, 28056995, 30886860, 34799616, 35787671	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	12452318, 12905081, 17459359, 17984618, 20005475, 23323620, 23685282, 23697560, 24333098, 25237043, 25448285, 26599441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12452318		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	20467232, 25253673	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	23243119, 25807426, 29446730		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34680942	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	18806098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17384900, 21114754, 21796615, 26150517, 29426835		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36050775	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29936317, 30038465, 30391265		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	15182962, 15318096		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27214654, 31026768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26937962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	29535452, 31368102		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33276716	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	28841898, 29206831, 30842089		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	28841898, 29206831	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	34362382	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28017615		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22508505, 28474171		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	28348376, 35657923	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29247577		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29247577	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28532411		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15714130, 19068087, 20590827, 21441790		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15714130		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19068087, 35102643	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Pseudocyst	Pancreatic Pseudocyst	BEFREE	16958672		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	10235286		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34267279	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Alcoholic	Pancreatitis	Pubtator	16273622	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	18336671		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	18336671		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	24037726, 25155611, 27377053, 30368588		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23786406, 24262192, 24491970, 25298080, 26130061, 27453488, 27612022, 27706693, 29936317, 30391265, 31831791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	27453488, 27612022, 27706693	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27453488		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	19469618	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	20042735		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	14742656, 20042735		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	15318096		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	11210104		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15123334, 16250071, 29401634		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36144737	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28532411		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25854761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	25411394, 25543168		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31250045		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24188068	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28431562		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	10470282, 12033531, 25573590		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31678551		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	25408144	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	15318096		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	7660963		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20166940, 26343594, 26941382		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28962150, 31368104		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	25759460, 27904031		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31831791		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12223435, 16759795, 17119048, 18033686, 18322963, 18429959, 20347291, 28594397, 29423536, 30173282		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16639733, 17033202, 17071628, 18322963		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12949054, 16269918, 16499490, 16639733, 17036331, 17071628, 17119048, 18033686, 18322963, 19449376, 19698717, 20128036, 20224884, 20521872, 20833657, 21048924, 21157980, 21672255, 21926110, 22292652, 22960999, 23009284, 23430454, 27038040, 28384229, 28464297, 28645180, 29423536, 30173282, 30639619, 31074772, 8850269, 9451664		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	16639733, 22960999		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17033202, 17489985, 21940907, 26804037, 28841898, 34010294, 34546328	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17033202, 17489985, 21576033, 21940907, 26804037, 28841898		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29286190		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	21958412, 27153870		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	25448285		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	14506613, 25392542, 25457208, 29063269, 30131474		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11238183, 15929164, 17631643, 21133627, 21507992, 22144473, 23455379, 24011243, 24633362, 25427912, 25524923, 28002588, 28036260, 29166882, 29254255, 29509552, 29616362, 30202044, 9744533		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21133627, 23079843, 28002588, 28036260, 29166882, 31957322, 32356421, 32426482, 39328412	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22155604, 28056995, 30955975, 34257742	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31493504		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	22507973		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29397435		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid valve disease	Pubtator	38177014	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24666523, 26992901	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15318096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular disease	Pubtator	18061070, 40603063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	CTD_human_DG	18596060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Remodeling	Vascular remodeling	Pubtator	38177014	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	29016726	Associate	★☆☆☆☆ Found in Text Mining only
Wernicke-Korsakoff Syndrome	Korsakoff psychosis	BEFREE	10776671		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wernicke-Korsakoff Syndrome	Korsakoff psychosis	PSYGENET_DG	10776671		★★☆☆☆ Found in Text Mining + Unknown/Other Associations