Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	10000
Gene name	AKT serine/threonine kinase 3
Gene symbol	AKT3
Synonyms (NCBI Gene)	MPPHMPPH2PKB-GAMMAPKBGPRKBGRAC-PK-gammaRAC-gammaSTK-2
Chromosome	1
Chromosome location	1q43-q44
Summary	The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of b

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs397514605	T>C	Pathogenic	Coding sequence variant, missense variant, genic upstream transcript variant
rs397514606	C>T	Pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant, genic upstream transcript variant
rs587776935	G>A	Likely-pathogenic, pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant, intron variant
rs886041100	A>T	Likely-pathogenic	Missense variant, coding sequence variant, genic upstream transcript variant
rs1064795602	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1085307712	T>G	Likely-pathogenic	Missense variant, coding sequence variant, genic upstream transcript variant
rs1574509510	T>C	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant

717

Show/Hide all (717)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003099	hsa-miR-122-5p	Luciferase reporter assayqRT-PCR	19296470
MIRT003334	hsa-miR-15a-5p	Review	20026422
MIRT003329	hsa-miR-16-5p	Review	20026422
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT003334	hsa-miR-15a-5p	Luciferase reporter assay	23233752
MIRT003329	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT003329	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT020391	hsa-miR-29c-3p	Sequencing	20371350
MIRT022432	hsa-miR-124-3p	Microarray	18668037
MIRT041618	hsa-miR-146b-5p	CLASH	23622248
MIRT572774	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT572773	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT572772	hsa-miR-6072	PAR-CLIP	20371350
MIRT572771	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT022432	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT568544	hsa-miR-548an	PAR-CLIP	20371350
MIRT568543	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT568542	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT568541	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT562676	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT562675	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562674	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT562673	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT562672	hsa-miR-569	PAR-CLIP	20371350
MIRT562671	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT562670	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT003329	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT482117	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT482115	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT482114	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT482113	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT482112	hsa-miR-595	PAR-CLIP	21572407
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT482110	hsa-miR-646	PAR-CLIP	21572407
MIRT482108	hsa-miR-3976	PAR-CLIP	21572407
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT482105	hsa-miR-520h	PAR-CLIP	21572407
MIRT482104	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT482101	hsa-miR-6134	PAR-CLIP	21572407
MIRT482100	hsa-miR-567	PAR-CLIP	21572407
MIRT482099	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT482095	hsa-miR-2054	PAR-CLIP	21572407
MIRT482096	hsa-miR-297	PAR-CLIP	21572407
MIRT003329	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT482117	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT482115	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT482114	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT482113	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT482112	hsa-miR-595	PAR-CLIP	23592263
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT482110	hsa-miR-646	PAR-CLIP	23592263
MIRT482108	hsa-miR-3976	PAR-CLIP	23592263
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT482105	hsa-miR-520h	PAR-CLIP	23592263
MIRT482104	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT482101	hsa-miR-6134	PAR-CLIP	23592263
MIRT482100	hsa-miR-567	PAR-CLIP	23592263
MIRT482099	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT482095	hsa-miR-2054	PAR-CLIP	23592263
MIRT482096	hsa-miR-297	PAR-CLIP	23592263
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT020391	hsa-miR-29c-3p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCR	28160548
MIRT731495	hsa-miR-29a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26512921
MIRT731495	hsa-miR-29a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26512921
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT482118	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	28254819
MIRT482118	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	28254819
MIRT053125	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	26482618
MIRT053125	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	26482618
MIRT735641	hsa-miR-29b-3p	Luciferase reporter assay	25784815
MIRT022432	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blotting	34277703
MIRT735546	hsa-miR-320a	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	33833996
MIRT735641	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32045877
MIRT735918	hsa-miR-641	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	32423991
MIRT482117	hsa-miR-424-5p	Luciferase reporter assayWestern blottingqRT-PCR	32520206
MIRT572774	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT572773	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT572772	hsa-miR-6072	PAR-CLIP	20371350
MIRT572771	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT022432	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT568544	hsa-miR-548an	PAR-CLIP	20371350
MIRT568543	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT568542	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT568541	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT562676	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT562675	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562674	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT562673	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT562672	hsa-miR-569	PAR-CLIP	20371350
MIRT562671	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT562670	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT003329	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT482117	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT482115	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT482114	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT482113	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT482112	hsa-miR-595	PAR-CLIP	21572407
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT482110	hsa-miR-646	PAR-CLIP	21572407
MIRT482108	hsa-miR-3976	PAR-CLIP	21572407
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT482105	hsa-miR-520h	PAR-CLIP	21572407
MIRT482104	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT482101	hsa-miR-6134	PAR-CLIP	21572407
MIRT482100	hsa-miR-567	PAR-CLIP	21572407
MIRT482099	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT482095	hsa-miR-2054	PAR-CLIP	21572407
MIRT482096	hsa-miR-297	PAR-CLIP	21572407
MIRT003329	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT482117	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT482115	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT482114	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT482113	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT482112	hsa-miR-595	PAR-CLIP	23592263
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT482110	hsa-miR-646	PAR-CLIP	23592263
MIRT482108	hsa-miR-3976	PAR-CLIP	23592263
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT482105	hsa-miR-520h	PAR-CLIP	23592263
MIRT482104	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT482101	hsa-miR-6134	PAR-CLIP	23592263
MIRT482100	hsa-miR-567	PAR-CLIP	23592263
MIRT482099	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT482095	hsa-miR-2054	PAR-CLIP	23592263
MIRT482096	hsa-miR-297	PAR-CLIP	23592263
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT776686	hsa-miR-1236	CLIP-seq
MIRT776687	hsa-miR-134	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT776689	hsa-miR-150	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776694	hsa-miR-24	CLIP-seq
MIRT776695	hsa-miR-3064-3p	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT776697	hsa-miR-3118	CLIP-seq
MIRT776698	hsa-miR-3136-5p	CLIP-seq
MIRT776699	hsa-miR-3153	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT776702	hsa-miR-326	CLIP-seq
MIRT776703	hsa-miR-330-3p	CLIP-seq
MIRT776704	hsa-miR-330-5p	CLIP-seq
MIRT776705	hsa-miR-3617	CLIP-seq
MIRT776706	hsa-miR-362-5p	CLIP-seq
MIRT776707	hsa-miR-3653	CLIP-seq
MIRT776708	hsa-miR-3658	CLIP-seq
MIRT776709	hsa-miR-371-5p	CLIP-seq
MIRT776710	hsa-miR-371b-5p	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776712	hsa-miR-4284	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT776715	hsa-miR-4439	CLIP-seq
MIRT776716	hsa-miR-4474-5p	CLIP-seq
MIRT776717	hsa-miR-4513	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT776720	hsa-miR-4698	CLIP-seq
MIRT776721	hsa-miR-4713-5p	CLIP-seq
MIRT776722	hsa-miR-4715-3p	CLIP-seq
MIRT776723	hsa-miR-4717-3p	CLIP-seq
MIRT776724	hsa-miR-4776-3p	CLIP-seq
MIRT776725	hsa-miR-4778-3p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776728	hsa-miR-500a	CLIP-seq
MIRT776729	hsa-miR-500b	CLIP-seq
MIRT776730	hsa-miR-502-5p	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT776732	hsa-miR-513c	CLIP-seq
MIRT776733	hsa-miR-514b-5p	CLIP-seq
MIRT776734	hsa-miR-532-3p	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT776736	hsa-miR-576-3p	CLIP-seq
MIRT776737	hsa-miR-579	CLIP-seq
MIRT776738	hsa-miR-875-3p	CLIP-seq
MIRT776739	hsa-miR-888	CLIP-seq
MIRT776740	hsa-miR-942	CLIP-seq
MIRT776741	hsa-miR-203	CLIP-seq
MIRT776742	hsa-miR-501-3p	CLIP-seq
MIRT776743	hsa-miR-502-3p	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT1545291	hsa-miR-4699-5p	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT1929348	hsa-miR-1245	CLIP-seq
MIRT1929349	hsa-miR-129-5p	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929352	hsa-miR-3117-3p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1929354	hsa-miR-3169	CLIP-seq
MIRT1929355	hsa-miR-361-3p	CLIP-seq
MIRT1929356	hsa-miR-3978	CLIP-seq
MIRT1929357	hsa-miR-409-3p	CLIP-seq
MIRT1929358	hsa-miR-4418	CLIP-seq
MIRT1929359	hsa-miR-4733-3p	CLIP-seq
MIRT1929360	hsa-miR-4759	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT1929361	hsa-miR-509-3-5p	CLIP-seq
MIRT1929362	hsa-miR-509-5p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT2169885	hsa-miR-29a	CLIP-seq
MIRT2169886	hsa-miR-29b	CLIP-seq
MIRT2169887	hsa-miR-29c	CLIP-seq
MIRT776698	hsa-miR-3136-5p	CLIP-seq
MIRT2169888	hsa-miR-3148	CLIP-seq
MIRT776699	hsa-miR-3153	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT776705	hsa-miR-3617	CLIP-seq
MIRT2169889	hsa-miR-3688-3p	CLIP-seq
MIRT776709	hsa-miR-371-5p	CLIP-seq
MIRT776710	hsa-miR-371b-5p	CLIP-seq
MIRT2169890	hsa-miR-3974	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2169892	hsa-miR-4320	CLIP-seq
MIRT2169893	hsa-miR-433	CLIP-seq
MIRT776715	hsa-miR-4439	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2169895	hsa-miR-4450	CLIP-seq
MIRT2169896	hsa-miR-448	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT2169897	hsa-miR-4633-5p	CLIP-seq
MIRT2169898	hsa-miR-4668-5p	CLIP-seq
MIRT2169899	hsa-miR-4694-3p	CLIP-seq
MIRT776720	hsa-miR-4698	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT776732	hsa-miR-513c	CLIP-seq
MIRT776733	hsa-miR-514b-5p	CLIP-seq
MIRT2169900	hsa-miR-532-5p	CLIP-seq
MIRT2169901	hsa-miR-570	CLIP-seq
MIRT776737	hsa-miR-579	CLIP-seq
MIRT2169902	hsa-miR-664	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT1929359	hsa-miR-4733-3p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2384061	hsa-miR-586	CLIP-seq
MIRT2426167	hsa-miR-105	CLIP-seq
MIRT2426168	hsa-miR-1237	CLIP-seq
MIRT1929348	hsa-miR-1245	CLIP-seq
MIRT2426169	hsa-miR-1248	CLIP-seq
MIRT2426170	hsa-miR-181a	CLIP-seq
MIRT2426171	hsa-miR-181b	CLIP-seq
MIRT2426172	hsa-miR-181c	CLIP-seq
MIRT2426173	hsa-miR-181d	CLIP-seq
MIRT2426174	hsa-miR-1910	CLIP-seq
MIRT2426175	hsa-miR-2115	CLIP-seq
MIRT2426176	hsa-miR-3606	CLIP-seq
MIRT2426177	hsa-miR-3689a-5p	CLIP-seq
MIRT2426178	hsa-miR-3689b	CLIP-seq
MIRT2426179	hsa-miR-3689e	CLIP-seq
MIRT2426180	hsa-miR-3689f	CLIP-seq
MIRT2426181	hsa-miR-4262	CLIP-seq
MIRT2426182	hsa-miR-455-3p	CLIP-seq
MIRT2169897	hsa-miR-4633-5p	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2426184	hsa-miR-516a-3p	CLIP-seq
MIRT2169900	hsa-miR-532-5p	CLIP-seq
MIRT2426185	hsa-miR-921	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT2435299	hsa-miR-23a	CLIP-seq
MIRT2435300	hsa-miR-23b	CLIP-seq
MIRT2435301	hsa-miR-23c	CLIP-seq
MIRT2435302	hsa-miR-300	CLIP-seq
MIRT2435303	hsa-miR-374c	CLIP-seq
MIRT2435304	hsa-miR-381	CLIP-seq
MIRT2435305	hsa-miR-4666-3p	CLIP-seq
MIRT2435306	hsa-miR-4738-5p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2435309	hsa-miR-624	CLIP-seq
MIRT2435310	hsa-miR-655	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2443529	hsa-miR-217	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT1929358	hsa-miR-4418	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT1929361	hsa-miR-509-3-5p	CLIP-seq
MIRT1929362	hsa-miR-509-5p	CLIP-seq
MIRT2472701	hsa-miR-101	CLIP-seq
MIRT2472702	hsa-miR-1202	CLIP-seq
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2472703	hsa-miR-1252	CLIP-seq
MIRT2472704	hsa-miR-1265	CLIP-seq
MIRT2472705	hsa-miR-1273e	CLIP-seq
MIRT2472706	hsa-miR-128	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT2472707	hsa-miR-1294	CLIP-seq
MIRT2472708	hsa-miR-1298	CLIP-seq
MIRT2472709	hsa-miR-1303	CLIP-seq
MIRT2472710	hsa-miR-1321	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2472711	hsa-miR-142-5p	CLIP-seq
MIRT2472712	hsa-miR-148a	CLIP-seq
MIRT2472713	hsa-miR-148b	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT2472714	hsa-miR-152	CLIP-seq
MIRT2472715	hsa-miR-1538	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT2472716	hsa-miR-1825	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT2472717	hsa-miR-205	CLIP-seq
MIRT2472718	hsa-miR-223	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT2472719	hsa-miR-3146	CLIP-seq
MIRT2472720	hsa-miR-3150b-3p	CLIP-seq
MIRT2472721	hsa-miR-3151	CLIP-seq
MIRT2472722	hsa-miR-3152-5p	CLIP-seq
MIRT2472723	hsa-miR-3157-5p	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT2472724	hsa-miR-3187-3p	CLIP-seq
MIRT2472725	hsa-miR-3189-3p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2472726	hsa-miR-320b	CLIP-seq
MIRT2472727	hsa-miR-320c	CLIP-seq
MIRT2472728	hsa-miR-320d	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT2472729	hsa-miR-340	CLIP-seq
MIRT2472730	hsa-miR-345	CLIP-seq
MIRT2472731	hsa-miR-34b	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT2472732	hsa-miR-3616-5p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT2472733	hsa-miR-3646	CLIP-seq
MIRT2472734	hsa-miR-3647-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT776707	hsa-miR-3653	CLIP-seq
MIRT776708	hsa-miR-3658	CLIP-seq
MIRT2472735	hsa-miR-3663-5p	CLIP-seq
MIRT2472736	hsa-miR-3677-5p	CLIP-seq
MIRT2472737	hsa-miR-3680	CLIP-seq
MIRT2472738	hsa-miR-376a	CLIP-seq
MIRT2472739	hsa-miR-376b	CLIP-seq
MIRT2472740	hsa-miR-3926	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT2472741	hsa-miR-3944-3p	CLIP-seq
MIRT2472742	hsa-miR-3972	CLIP-seq
MIRT2169890	hsa-miR-3974	CLIP-seq
MIRT2472743	hsa-miR-412	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2472744	hsa-miR-4275	CLIP-seq
MIRT2472745	hsa-miR-4281	CLIP-seq
MIRT2472746	hsa-miR-4283	CLIP-seq
MIRT2472747	hsa-miR-4292	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT2472748	hsa-miR-4308	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2472749	hsa-miR-4316	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT2472750	hsa-miR-4423-5p	CLIP-seq
MIRT2472751	hsa-miR-4429	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT2472752	hsa-miR-4435	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT2472753	hsa-miR-4473	CLIP-seq
MIRT2472754	hsa-miR-4487	CLIP-seq
MIRT2472755	hsa-miR-4489	CLIP-seq
MIRT2472756	hsa-miR-4491	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT2472757	hsa-miR-4503	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT2472758	hsa-miR-4521	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT2472759	hsa-miR-4633-3p	CLIP-seq
MIRT2472760	hsa-miR-4635	CLIP-seq
MIRT2472761	hsa-miR-4639-3p	CLIP-seq
MIRT2472762	hsa-miR-4643	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT2472763	hsa-miR-4657	CLIP-seq
MIRT2472764	hsa-miR-4659a-3p	CLIP-seq
MIRT2472765	hsa-miR-4659b-3p	CLIP-seq
MIRT2472766	hsa-miR-466	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT2435305	hsa-miR-4666-3p	CLIP-seq
MIRT2472767	hsa-miR-4670-3p	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT2472768	hsa-miR-4686	CLIP-seq
MIRT2472769	hsa-miR-4689	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2472770	hsa-miR-4697-3p	CLIP-seq
MIRT2472771	hsa-miR-4701-5p	CLIP-seq
MIRT2472772	hsa-miR-4707-3p	CLIP-seq
MIRT2472773	hsa-miR-4719	CLIP-seq
MIRT2472774	hsa-miR-4739	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT2472775	hsa-miR-4742-3p	CLIP-seq
MIRT2472776	hsa-miR-4745-3p	CLIP-seq
MIRT2472777	hsa-miR-4755-3p	CLIP-seq
MIRT2472778	hsa-miR-4756-5p	CLIP-seq
MIRT2472779	hsa-miR-4760-3p	CLIP-seq
MIRT2472780	hsa-miR-4767	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT2472781	hsa-miR-4784	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT2472782	hsa-miR-4789-3p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2472783	hsa-miR-486-3p	CLIP-seq
MIRT2472784	hsa-miR-487a	CLIP-seq
MIRT2472785	hsa-miR-510	CLIP-seq
MIRT2472786	hsa-miR-512-3p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT2472787	hsa-miR-520f	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT2472788	hsa-miR-548s	CLIP-seq
MIRT2472789	hsa-miR-548v	CLIP-seq
MIRT2472790	hsa-miR-573	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT2472791	hsa-miR-588	CLIP-seq
MIRT2472792	hsa-miR-596	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2472793	hsa-miR-626	CLIP-seq
MIRT2472794	hsa-miR-630	CLIP-seq
MIRT2472795	hsa-miR-661	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT2472796	hsa-miR-767-3p	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT2472797	hsa-miR-877	CLIP-seq
MIRT2472701	hsa-miR-101	CLIP-seq
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2472703	hsa-miR-1252	CLIP-seq
MIRT2472705	hsa-miR-1273e	CLIP-seq
MIRT2472706	hsa-miR-128	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT2472707	hsa-miR-1294	CLIP-seq
MIRT2472708	hsa-miR-1298	CLIP-seq
MIRT2674876	hsa-miR-1305	CLIP-seq
MIRT2472710	hsa-miR-1321	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2472711	hsa-miR-142-5p	CLIP-seq
MIRT2472712	hsa-miR-148a	CLIP-seq
MIRT2472713	hsa-miR-148b	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT2472714	hsa-miR-152	CLIP-seq
MIRT2472715	hsa-miR-1538	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT2472717	hsa-miR-205	CLIP-seq
MIRT2472718	hsa-miR-223	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT2472719	hsa-miR-3146	CLIP-seq
MIRT2472720	hsa-miR-3150b-3p	CLIP-seq
MIRT2472721	hsa-miR-3151	CLIP-seq
MIRT2472722	hsa-miR-3152-5p	CLIP-seq
MIRT2472723	hsa-miR-3157-5p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2472726	hsa-miR-320b	CLIP-seq
MIRT2472727	hsa-miR-320c	CLIP-seq
MIRT2472728	hsa-miR-320d	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT2472729	hsa-miR-340	CLIP-seq
MIRT2472730	hsa-miR-345	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT2472732	hsa-miR-3616-5p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT2472734	hsa-miR-3647-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT2472735	hsa-miR-3663-5p	CLIP-seq
MIRT2472736	hsa-miR-3677-5p	CLIP-seq
MIRT2472737	hsa-miR-3680	CLIP-seq
MIRT2674877	hsa-miR-3691-5p	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT2472741	hsa-miR-3944-3p	CLIP-seq
MIRT2472743	hsa-miR-412	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2472744	hsa-miR-4275	CLIP-seq
MIRT2472745	hsa-miR-4281	CLIP-seq
MIRT2472746	hsa-miR-4283	CLIP-seq
MIRT2472747	hsa-miR-4292	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT2472748	hsa-miR-4308	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2472749	hsa-miR-4316	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT2472751	hsa-miR-4429	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2674878	hsa-miR-4443	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT2472753	hsa-miR-4473	CLIP-seq
MIRT2674879	hsa-miR-4480	CLIP-seq
MIRT2472754	hsa-miR-4487	CLIP-seq
MIRT2472755	hsa-miR-4489	CLIP-seq
MIRT2472756	hsa-miR-4491	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT2472757	hsa-miR-4503	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT2472759	hsa-miR-4633-3p	CLIP-seq
MIRT2472760	hsa-miR-4635	CLIP-seq
MIRT2472761	hsa-miR-4639-3p	CLIP-seq
MIRT2472762	hsa-miR-4643	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT2472763	hsa-miR-4657	CLIP-seq
MIRT2472766	hsa-miR-466	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT2472767	hsa-miR-4670-3p	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT2472768	hsa-miR-4686	CLIP-seq
MIRT2472769	hsa-miR-4689	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2472770	hsa-miR-4697-3p	CLIP-seq
MIRT2472772	hsa-miR-4707-3p	CLIP-seq
MIRT2472773	hsa-miR-4719	CLIP-seq
MIRT2472774	hsa-miR-4739	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT2472775	hsa-miR-4742-3p	CLIP-seq
MIRT2472776	hsa-miR-4745-3p	CLIP-seq
MIRT2674880	hsa-miR-4752	CLIP-seq
MIRT2472778	hsa-miR-4756-5p	CLIP-seq
MIRT2472779	hsa-miR-4760-3p	CLIP-seq
MIRT2472780	hsa-miR-4767	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT2472781	hsa-miR-4784	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT2472782	hsa-miR-4789-3p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2472783	hsa-miR-486-3p	CLIP-seq
MIRT2472784	hsa-miR-487a	CLIP-seq
MIRT2472786	hsa-miR-512-3p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT2472787	hsa-miR-520f	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT2472789	hsa-miR-548v	CLIP-seq
MIRT2472790	hsa-miR-573	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT2472792	hsa-miR-596	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2472793	hsa-miR-626	CLIP-seq
MIRT2472794	hsa-miR-630	CLIP-seq
MIRT2472795	hsa-miR-661	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT2472796	hsa-miR-767-3p	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	25323119
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10092583
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16540465
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12176997, 17544405, 19713527, 20059950, 25036637, 25241761, 33961781
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0006468	Process	Protein phosphorylation	TAS	10092583
GO:0007165	Process	Signal transduction	IMP	18524868
GO:0007165	Process	Signal transduction	TAS	10092583
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036064	Component	Ciliary basal body	IDA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	28254819
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0048854	Process	Brain morphogenesis	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	25323119
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IDA	28254819
GO:1905653	Process	Positive regulation of artery morphogenesis	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IMP	25323119

MIM	HGNC	e!Ensembl
611223	393	ENSG00000117020

Q9Y243

Protein name

RAC-gamma serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-3) (Protein kinase B gamma) (PKB gamma) (RAC-PK-gamma) (STK-2)

Protein function

AKT3 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated throug

PDB

2X18 , 8ZXW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	6 → 107	PH domain	Domain
PF00069	Pkinase	148 → 405	Protein kinase domain	Domain
PF00433	Pkinase_C	426 → 473	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: In adult tissues, it is highly expressed in brain, lung and kidney, but weakly in heart, testis and liver. In fetal tissues, it is highly expressed in heart, liver and brain and not at all in kidney.

Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE

Sequence length

479

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
AKT3-related disorder	Likely pathogenic; Pathogenic	rs587776935	RCV004532479	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Capillary hemangioma	Likely pathogenic; Pathogenic	rs587776935	RCV000415230	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cns neuroblastoma with FOXR2 activation	Pathogenic	rs397514606	RCV006253706	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Likely pathogenic; Pathogenic	rs587776935	RCV000415230	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrocephaly	Likely pathogenic; Pathogenic	rs587776935	RCV000415230	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma	Pathogenic	rs397514606	RCV006253705	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Megalencephaly-capillary malformation-polymicrogyria syndrome	Pathogenic	rs397514605	RCV000416600	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 2	Likely pathogenic; Pathogenic	rs1064795602, rs2147921624, rs2147812145, rs2147921662, rs886041100, rs587776935, rs397514605, rs397514606, rs1673171921	RCV001376775 RCV001728019 RCV001775235 RCV001775452 RCV000258932 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neoplasm	Likely pathogenic; Pathogenic	rs587776935	RCV004668745	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Overgrowth syndrome and/or cerebral malformations due to abnormalities in MTOR pathway genes	Pathogenic	rs397514606	RCV001836719	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polymicrogyria	Likely pathogenic; Pathogenic	rs587776935	RCV000415230	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME 16	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMIMEGALENCEPHALY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALFORMATIONS OF CORTICAL DEVELOPMENT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY	—	ClinGen, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENIOR-LOKEN SYNDROME 7	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (203)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29282901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31671832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	17668379, 18053786, 29282901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33220166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18160256, 23873136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	18160256, 23873136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	29282901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28389565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31470874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28389565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34103010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28969385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	28969385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27329362, 29435054, 29556282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	36226386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10419456, 24138071, 24463007, 27297869, 28160548, 29242214, 29556282, 31752925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10419456, 22722202, 23929892, 25927147, 27297869, 28160548, 29636477, 31781306, 32444848, 37834358, 40403210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19759907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	25416470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28733453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10419456, 15133472, 17047397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25424347, 26002580, 33289700, 38033034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21777670, 28500316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26909918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23378641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31672157	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25855050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17178867, 26512921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	21821713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35208504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	GWASCAT_DG	28346443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28028179, 30186040, 30555259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26222778, 32453706, 34919787, 34950443, 36499586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	22500628, 25091978, 28969385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	30535467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23378641, 31672157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30535467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	CTD_human_DG	22729223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	25833943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31304004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37834358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31404142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	28969385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28969385, 37088138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37680885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19346957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27421659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	10208883, 15627943, 21159799, 21800092, 22228622, 22729224, 25523067, 28190287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	25424989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30108448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30442683, 33690729, 40090626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21159799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26512921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10908564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	22546513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30097674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	36342087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31480991		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	19965620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17934521, 24967401, 25501707, 26481529, 26902608, 26993778, 27422127, 31470874, 31660951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17934521, 24967401, 25501707, 26782072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24967401, 25501707, 26481529, 26902608, 26993778, 27422127, 31470874, 31660951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	19818351, 20167810, 27422127	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	25737557		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	GWASCAT_DG	28346443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28733453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	31074018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	ORPHANET_DG	22500628		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemimegalencephaly	Hemimegalencephaly	Pubtator	22500628, 22729223, 23101622, 23319189, 31444548	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemimegalencephaly	Hemimegalencephaly	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemimegalencephaly	Hemimegalencephaly	BEFREE	22729223, 23101622, 23794269, 25091978, 25451314, 28969385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemimegalencephaly	Hemimegalencephaly	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	15133472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27903978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	27903978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	33690729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	33176720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	22729222, 25523067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	22729222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30053339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	28352194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	25091978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25424989, 28283832, 28467426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	21590431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21590431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31692069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	28190287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36771423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24244539, 24247267, 25370363, 25424347, 26002580, 27611696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25855050, 27048287, 28500316, 37731502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	23794269, 24039187, 25091978, 25416470, 25523067, 28190287, 28969385		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	25833943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	CTD_human_DG	22729223		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Malformation of cortical development	BEFREE	25091978, 26523971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	28969385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	20167810, 25737557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10419456, 24138071, 24463007, 27297869, 28160548, 29242214, 29556282, 31752925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24244539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11489829, 21777670, 28500316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17178867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31646811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10419456, 11489829, 28624527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29228422, 30927924, 31576144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28560065, 28962076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18813315, 20167810, 25722288, 26741489, 27297869, 28515962, 28624527, 29367689, 30448735, 31590614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15987444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22410780, 24463007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	CTD_human_DG	22729224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	ORPHANET_DG	22729224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	CLINVAR_DG	22729224, 23745724, 25416470, 25523067, 28086757		★★★★★ ★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 1	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	GENOMICS_ENGLAND_DG	22500628, 22729224		★★★★★ ★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 2	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	UNIPROT_DG	22500628, 22729223, 22729224, 23745724		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 2	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	GENOMICS_ENGLAND_DG	22729223		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 2	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	CLINVAR_DG	22729224, 23745724, 24705253		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Megalencephaly-polymicrogyria-postaxial polydactyly-hydrocephalus syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15466193, 17440074, 18451171, 18794153, 18813315, 22549727, 25452114, 28064546, 28853983, 29391600, 31138602		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15466193, 18451171, 18813315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18813315, 20647317, 22549727, 25452114, 25595898, 28852061, 37931033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	27548314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29202451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	17668379, 24039187, 25424989, 28283832, 28328126, 30053339		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	Pubtator	28283832	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33087445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27919956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33794982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30787430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34944006	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10419456, 11489829, 15133472, 15466193, 17440074, 18451171, 18794153, 19818351, 21351097, 22499437, 24244539, 24247267, 24335962, 24463007, 25737557 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	24039187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29321317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22499437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21777670, 24942865, 27072269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29202451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29367689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	28733453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 2A	Osteogenesis imperfecta	Pubtator	36226386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30737029		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17178867		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17178867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27629740, 31703725, 32878513, 37303048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31646811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31646811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26482618, 28849051, 31101684, 31160577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	28969385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31655798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG	22729223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	28969385		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polymicrogyria	Polymicrogyria	Pubtator	28969385	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polymicrogyria	Polymicrogyria	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate carcinoma	Prostate cancer	BEFREE	10419456, 11489829, 28624527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10419456, 16721361, 22546513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11489829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27075409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30136020, 31518563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36640125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23378641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31398659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31043342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	22984568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	23974872, 26198764, 28991256, 29483656, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	23974872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	28467426, 31522868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	29197138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28296904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25122428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	28190287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15543611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30659640, 31582906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28733453, 33811778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29228422, 30927924, 31576144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29228422, 31480991, 34983559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25451314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	34882061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29766503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28849051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28560065, 28962076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28560065, 28962076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22722202, 28160548, 33495420, 37569854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24138071, 24335962, 26741489, 28160548, 29298117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	25833943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulnar polydactyly of fingers	Postaxial hand polydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23698120, 26148825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	26397152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30283446, 31293179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30097674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30825222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36640125	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	25091978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	32572913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AKT3 (AKT serine/threonine kinase 3)