AKT1 (AKT serine/threonine kinase 1)

Gene

• Entrez ID: 207
• Gene name: AKT serine/threonine kinase 1
• Gene symbol: AKT1
• Synonyms (NCBI Gene): AKT, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain,

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434592	C>T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs368667384	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs397514644	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs397514645	T>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057518602	T>C	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1057519804	G>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1595251483	TC>CT	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003984	hsa-miR-199a-3p	Western blot	18456660
MIRT004363	hsa-miR-125b-5p	qRT-PCR, Western blot	18649363
MIRT004701	hsa-miR-185-5p	Flow, Immunoblot, Microarray, qRT-PCR	19688090
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005740	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007179	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23104321
MIRT005355	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR;Other	20623644
MIRT029530	hsa-miR-26b-5p	Microarray	19088304
MIRT041236	hsa-miR-193b-3p	CLASH	23622248
MIRT053334	hsa-miR-100-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23724047
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25400827
MIRT054875	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	25414595
MIRT437386	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT437912	hsa-miR-105-5p	Luciferase reporter assay, Western blot	25280563
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridization, qRT-PCR	23963114
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridization, qRT-PCR	23963114
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731198	hsa-miR-637	Immunohistochemistry, In situ hybridization, Western blot, Luciferase reporter assay	25597410
MIRT731198	hsa-miR-637	Immunohistochemistry, In situ hybridization, Western blot, Luciferase reporter assay	25597410
MIRT731805	hsa-miR-495-3p	Luciferase reporter assay, qRT-PCR, Western blot	27323412
MIRT731805	hsa-miR-495-3p	Luciferase reporter assay, qRT-PCR, Western blot	27323412
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT000425	hsa-miR-184	Luciferase reporter assay	27666871
MIRT736014	hsa-miR-126-3p	qRT-PCR, Western blot	26659078
MIRT732949	hsa-miR-4443	Microarray	33511213
MIRT735075	hsa-miR-6089	Luciferase reporter assay, Western blotting, qRT-PCR	33028811
MIRT736013	hsa-miR-23b-3p	Immunofluorescence, qRT-PCR, Flow cytometry	32865424
MIRT736014	hsa-miR-126-3p	qRT-PCR	32865424
MIRT736501	hsa-miR-148a-3p	qRT-PCR	32624692
MIRT737431	hsa-miR-429	Luciferase reporter assay, Western blotting, qRT-PCR	31814979
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT755928	hsa-miR-142-3p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays	35194440
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776417	hsa-miR-183	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT776420	hsa-miR-2681	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776438	hsa-miR-1243	CLIP-seq
MIRT776439	hsa-miR-1255a	CLIP-seq
MIRT776440	hsa-miR-1255b	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT776445	hsa-miR-3185	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT776447	hsa-miR-3616-3p	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT776451	hsa-miR-3919	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776452	hsa-miR-4273	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776454	hsa-miR-4303	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT776456	hsa-miR-4445	CLIP-seq
MIRT776457	hsa-miR-4446-3p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776459	hsa-miR-4462	CLIP-seq
MIRT776460	hsa-miR-4504	CLIP-seq
MIRT776461	hsa-miR-4511	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776463	hsa-miR-4656	CLIP-seq
MIRT776464	hsa-miR-4677-5p	CLIP-seq
MIRT776465	hsa-miR-4709-3p	CLIP-seq
MIRT776466	hsa-miR-4717-5p	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT776469	hsa-miR-4756-3p	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776471	hsa-miR-548aa	CLIP-seq
MIRT776472	hsa-miR-548c-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776477	hsa-miR-891b	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT1929179	hsa-miR-1273	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929181	hsa-miR-136	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT1929185	hsa-miR-3074-5p	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT1929188	hsa-miR-3158-3p	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT1929190	hsa-miR-3180	CLIP-seq
MIRT1929191	hsa-miR-3180-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT1929193	hsa-miR-3196	CLIP-seq
MIRT1929194	hsa-miR-3202	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929196	hsa-miR-3613-5p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT1929201	hsa-miR-4271	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT1929202	hsa-miR-4421	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT1929206	hsa-miR-455-3p	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT1929211	hsa-miR-4716-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929213	hsa-miR-4723-5p	CLIP-seq
MIRT1929214	hsa-miR-4725-3p	CLIP-seq
MIRT1929215	hsa-miR-4728-5p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929218	hsa-miR-4740-3p	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929222	hsa-miR-501-3p	CLIP-seq
MIRT1929223	hsa-miR-502-3p	CLIP-seq
MIRT1929224	hsa-miR-539	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT1929226	hsa-miR-561	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT1929229	hsa-miR-661	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT2169824	hsa-miR-3200-5p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2169825	hsa-miR-4281	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT2169826	hsa-miR-4726-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT2472683	hsa-miR-3200-3p	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT2472685	hsa-miR-374c	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2472687	hsa-miR-4268	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT2472688	hsa-miR-4448	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT2472689	hsa-miR-4698	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT2472690	hsa-miR-4731-3p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT2472691	hsa-miR-4801	CLIP-seq
MIRT2472692	hsa-miR-4803	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT2472693	hsa-miR-548ac	CLIP-seq
MIRT2472694	hsa-miR-548ae	CLIP-seq
MIRT2472695	hsa-miR-548aj	CLIP-seq
MIRT2472696	hsa-miR-548am	CLIP-seq
MIRT2472697	hsa-miR-548d-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT2472698	hsa-miR-548x	CLIP-seq
MIRT2472699	hsa-miR-548z	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT2472700	hsa-miR-655	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APC	Repression	15888491
AR	Activation	11278645
AR	Repression	20589722
GLI1	Unknown	23580656
NFKB1	Repression	18031796
RELA	Repression	18031796
STAT3	Unknown	16007214
TP53	Repression	12485897

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001649	Process	Osteoblast differentiation	IDA	22869525
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001893	Process	Maternal placenta development	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19850054
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0002430	Process	Complement receptor mediated signaling pathway	IDA	19162005
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	18558630
GO:0004672	Function	Protein kinase activity	IDA	31204173
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10570282
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	10376603, 17030608
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8524413, 10102273, 10983986, 11994271, 12172553, 14749367, 15861136, 16139227, 16540465, 17386266, 19667065, 23512198, 24529379, 26440888, 29343641, 30504268, 30514904, 31548394, 32322062, 33594058
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	19573808
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	21432781, 21711983
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	19162005, 22797923
GO:0005515	Function	Protein binding	IPI	10102273, 10983986, 11154276, 11438723, 11839802, 12176997, 12244133, 12791994, 16044149, 16139227, 16280327, 16282323, 16417524, 16525023, 16537421, 16792529, 17006541, 17577629, 17932490, 18191226, 18292230, 18505846, 18562279, 18624398, 18650932, 18786403, 19122674, 19162005, 191
GO:0005516	Function	Calmodulin binding	IDA	29104511
GO:0005524	Function	ATP binding	IC	11994271
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005524	Function	ATP binding	IEA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	19203586
GO:0005634	Component	Nucleus	IDA	20333297
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	21432781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	26440888
GO:0005737	Component	Cytoplasm	IDA	19203586, 25190803
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	21432781
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	21045808
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	14749367, 19203586, 20333297
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	21432781
GO:0005911	Component	Cell-cell junction	IEA
GO:0005929	Component	Cilium	IDA
GO:0005938	Component	Cell cortex	NAS	19126672
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IMP	8940145
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	IDA	30193097
GO:0006413	Process	Translational initiation	IDA	16289705
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14749367
GO:0006468	Process	Protein phosphorylation	IDA	11994271, 23431171
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	33594058
GO:0006606	Process	Protein import into nucleus	IMP	16280327
GO:0006607	Process	NLS-bearing protein import into nucleus	IDA	14645851
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	10376602
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	17684057
GO:0006893	Process	Golgi to plasma membrane transport	IDA	35343654
GO:0006915	Process	Apoptotic process	IEA
GO:0006924	Process	Activation-induced cell death of T cells	IMP	14749367
GO:0006954	Process	Inflammatory response	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007165	Process	Signal transduction	TAS	10570282, 21432781
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	20878056
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	18483258
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10570282
GO:0007281	Process	Germ cell development	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008283	Process	Cell population proliferation	TAS	21432781
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IMP	8978681
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009267	Process	Cellular response to starvation	IDA	24529379
GO:0009408	Process	Response to heat	IEA
GO:0009408	Process	Response to heat	TAS	10958679
GO:0009725	Process	Response to hormone	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	18387192
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	18558630
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	28341552
GO:0010628	Process	Positive regulation of gene expression	ISS	18292230
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010761	Process	Fibroblast migration	NAS	19126672
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010765	Process	Positive regulation of sodium ion transport	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IDA	24529379
GO:0016020	Component	Membrane	IEA
GO:0016242	Process	Negative regulation of macroautophagy	NAS	23778976
GO:0016301	Function	Kinase activity	IDA	14749367
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	IDA	20333297
GO:0016477	Process	Cell migration	IDA	23512198
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16139227, 32322062
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	20605787
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	ISS
GO:0019900	Function	Kinase binding	IPI	21177249
GO:0019901	Function	Protein kinase binding	IEA
GO:0022605	Process	Mammalian oogenesis stage	IEA
GO:0030027	Component	Lamellipodium	NAS	19126672
GO:0030154	Process	Cell differentiation	TAS	21432781
GO:0030163	Process	Protein catabolic process	IEA
GO:0030235	Function	Nitric-oxide synthase regulator activity	IMP	10376603
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	ISS
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	TAS	21711983
GO:0030307	Process	Positive regulation of cell growth	IDA	19203586
GO:0030334	Process	Regulation of cell migration	IMP	19934221
GO:0030334	Process	Regulation of cell migration	TAS	21432781
GO:0030335	Process	Positive regulation of cell migration	IDA	35609316
GO:0030335	Process	Positive regulation of cell migration	IDA	38020884
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	21177249
GO:0030336	Process	Negative regulation of cell migration	IDA	27494834
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	18485873, 29343641
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	39880951
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	18292230
GO:0031641	Process	Regulation of myelination	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708, 36528027
GO:0031929	Process	TOR signaling	NAS	23778976
GO:0031982	Component	Vesicle	IDA	16792529
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032079	Process	Positive regulation of endodeoxyribonuclease activity	IDA	20605787
GO:0032094	Process	Response to food	IEA
GO:0032287	Process	Peripheral nervous system myelin maintenance	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	23512198
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	12172553, 17386266, 24529379
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032991	Component	Protein-containing complex	IDA	20878056, 23223530
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	19667065
GO:0033554	Process	Cellular response to stress	TAS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IDA	35343654
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	35343654
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	10196138
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058, 35338845
GO:0034405	Process	Response to fluid shear stress	IMP	10376603
GO:0035519	Process	Protein K29-linked ubiquitination	IDA	33594058
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	21321938
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0036294	Process	Cellular response to decreased oxygen levels	IEA
GO:0036316	Process	SREBP-SCAP complex retention in endoplasmic reticulum	IDA	12202038, 15899885, 32322062
GO:0036416	Process	TRNA stabilization	IDA	36599982, 36599985
GO:0036444	Process	Calcium import into the mitochondrion	IDA	22925203, 32494073
GO:0036444	Process	Calcium import into the mitochondrion	IMP	23755363
GO:0036499	Process	PERK-mediated unfolded protein response	IDA	25925385, 31023583
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IPI	7891724, 17554339, 35512704
GO:0042803	Function	Protein homodimerization activity	IDA	10983986
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043001	Process	Golgi to plasma membrane protein transport	IMP	25673879
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19203586
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23512198
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043276	Process	Anoikis	NAS	23778976
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	19203586
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19162005, 21321938, 28147277
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	9373175, 18483258, 28341552
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	21711983
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	20011604
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	10376603
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	12177166
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IMP	12177166
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	8940145
GO:0045724	Process	Positive regulation of cilium assembly	IDA	26258637
GO:0045724	Process	Positive regulation of cilium assembly	IMP	25673879, 31204173
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0045746	Process	Negative regulation of Notch signaling pathway	TAS
GO:0045861	Process	Negative regulation of proteolysis	IMP	18387192
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19057511
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046326	Process	Positive regulation of D-glucose import	IMP	8940145, 16814735
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0046777	Process	Protein autophosphorylation	TAS	16280327
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IDA	32322062
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	8940145
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IMP	8978681
GO:0048266	Process	Behavioral response to pain	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21321938
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0051604	Process	Protein maturation	EXP	11163209
GO:0051604	Process	Protein maturation	IDA	11163209
GO:0051604	Process	Protein maturation	IMP	21719679
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060416	Process	Response to growth hormone	ISS
GO:0060627	Process	Regulation of vesicle-mediated transport	IMP	31204173
GO:0060644	Process	Mammary gland epithelial cell differentiation	TAS	21432781
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061512	Process	Protein localization to cilium	IMP	25673879
GO:0070141	Process	Response to UV-A	IDA	18483258
GO:0070848	Process	Response to growth factor	IDA	33505021
GO:0070972	Process	Protein localization to endoplasmic reticulum	IDA	35343654
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	35343654
GO:0071277	Process	Cellular response to calcium ion	IDA	32494073
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	30514904
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071889	Function	14-3-3 protein binding	IPI	10102273
GO:0072350	Process	Tricarboxylic acid metabolic process	IDA	30193097
GO:0072655	Process	Establishment of protein localization to mitochondrion	IMP	23962723
GO:0072656	Process	Maintenance of protein location in mitochondrion	IMP	23962723
GO:0072752	Process	Cellular response to rapamycin	ISS
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	ISS
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097700	Process	Vascular endothelial cell response to laminar fluid shear stress	TAS
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099104	Function	Potassium channel activator activity	IDA	33505021
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0106004	Process	TRNA (guanine-N7)-methylation	IDA	36599982, 36599985
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	TAS
GO:0110002	Process	Regulation of tRNA methylation	IDA	15861136
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:0140896	Process	CGAS/STING signaling pathway	IDA	30842659, 30842662, 32911482, 32912999
GO:0150033	Process	Negative regulation of protein localization to lysosome	IDA	24529379
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	12172553, 26440888
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18483258
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	20605787
GO:1901653	Process	Cellular response to peptide	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902018	Process	Negative regulation of cilium assembly	IDA	31204173
GO:1902018	Process	Negative regulation of cilium assembly	IMP	31204173
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	NAS	16604263
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	8940145
GO:1903318	Process	Negative regulation of protein maturation	ISS
GO:1903384	Process	Negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IMP	21177249
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	ISS
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	9045618, 12906785, 17386266, 26972053, 33594058, 35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708, 33594058, 36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	12172553, 17386266, 24529379, 30514904, 31548394, 33594058
GO:1904515	Process	Positive regulation of TORC2 signaling	IEA
GO:1904841	Function	TORC2 complex binding	IDA	21177249
GO:1905552	Process	Positive regulation of protein localization to endoplasmic reticulum	IDA	32322062
GO:1905786	Process	Positive regulation of anaphase-promoting complex-dependent catabolic process	IDA	29343641
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IMP	20605787
GO:1990418	Process	Response to insulin-like growth factor stimulus	ISS
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA
GO:2000074	Process	Regulation of type B pancreatic cell development	TAS
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 164730
• HGNC: 391
• e!Ensembl: ENSG00000142208

Protein

• UniProt ID: P31749
• Protein name: RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)
• Protein function: AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis (PubMed:11882383, PubMed
• PDB: 1H10, 1UNP, 1UNQ, 1UNR, 2UVM, 2UZR, 2UZS, 3CQU, 3CQW, 3MV5, 3MVH, 3O96, 3OCB, 3OW4, 3QKK, 3QKL, 3QKM, 4EJN, 4EKK, 4EKL, 4GV1, 5KCV, 6BUU, 6CCY, 6HHF, 6HHG, 6HHH, 6HHI, 6HHJ, 6NPZ, 6S9W, 6S9X, 7APJ, 7MYX, 7NH4, 7NH5, 8JOW, 8UVY, 8UW2, 8UW7, 8UW9, 8ZPU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	6 → 108	PH domain	Domain
  PF00069	Pkinase	150 → 408	Protein kinase domain	Domain
  PF00433	Pkinase_C	429 → 474	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in prostate cancer and levels increase from the normal to the malignant state (at protein level). Expressed in all human cell types so far analyzed. The Tyr-176 phosphorylated form shows a significant increase in expression i
• Sequence:

  MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
  QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
  RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
  LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
  RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
  KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
  ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
  LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
  

• Sequence length: 480

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Breast adenocarcinoma	Pathogenic	rs121434592	RCV000015017	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carcinoma of colon	Pathogenic	rs121434592	RCV000015018	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cowden syndrome 6	Pathogenic	rs121434592, rs397514644, rs397514645	RCV000795313 RCV000033177 RCV000033178	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Pathogenic	rs121434592	RCV006253621	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma SHH activated and TP53 wild-type	Pathogenic	rs121434592	RCV006253622	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Pathogenic	rs121434592	RCV005647963	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs121434592	RCV004668732	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian neoplasm	Pathogenic	rs121434592	RCV000015019	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus syndrome	Pathogenic	rs121434592, rs1595251483	RCV000031926 RCV000984546	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AKT1-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE, CALCIFICATION OF	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOGENESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar ClinVar, HPO ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COWDEN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COWDEN SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar ClinVar, HPO ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Benign; Likely benign	ClinVar CTD, Disgenet CTD, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	32152504	Associate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	18199958, 20856158, 25245477		★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
ACTIVATED PI3K-DELTA SYNDROME	ACTIVATED PI3K-DELTA SYNDROME	BEFREE	29675019		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18054314		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12556562, 18392055, 24850755		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18665177, 22185211, 24244612, 27018341, 27717743, 27725691, 30669372, 31275848, 31560953		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	19638627, 23380710		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27531894, 29296810, 31056348		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28117219, 29620213, 30694771, 31531867, 31810129		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	12556562		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24676995, 27840989, 29115618, 30536958		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25248926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12097266, 17050554, 17493236, 19046792, 19925030, 20881644, 23667466, 25307974, 27013585, 27189341, 27334835, 29278885, 29443392, 3037531, 30978501, 31289489, 31572671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15102693, 17504381		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27903235, 30153579		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18404164, 19337377, 22135231, 22653055, 23629727, 23667466, 24374738, 25273224, 25978653, 26468985, 26654940, 27178741, 27494877, 27655485, 27822469, 28152510, 28737828, 28939129, 28982179, 29271375, 29516506, 29596836, 29620222, 30069312, 30496797, 30590030, 30791942, 30815935, 30942957, 31186081, 31355526, 31436252, 31630149		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19405118		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11901476, 27050099, 29121168, 29894516		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	31372739		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11756242, 21127195, 29339153		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18351386		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26033966		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	24573033, 29467273		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	29075302, 31322702		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	23055545		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31671832		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27717743, 27725691, 30669372, 30688831		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	15331441, 22609116, 23840064, 24418330, 25909227, 27348272, 28627414		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15772702, 17375124, 30352904, 30610809, 31128034		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30112810		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	12060623, 16707597, 19887560, 21861842, 24300787, 25601471, 27012813, 28159923, 28650469, 29682173, 30050750, 30244244, 30670636		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	24569712, 30577817, 31744878		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	17669465		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	31857685	Associate	★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	30833420		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12645527, 16014629, 18818877, 22044025, 23095849, 24077433, 24735980, 26178916, 28025562, 28922161, 30080220, 30611996, 32192109, 32980851, 33605427, 33714141, 33834692, 34336099, 34977242, 35178230, 36065437, 37009506, 38039290, 39684911, 40141059, 40273555, 40642087	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32035419	Inhibit	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18826385		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	LHGDN	18826385		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	32719259	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29404958		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	23023706		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21228060, 31570855		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28158451, 31196199, 37682161	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	17303436		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18195102, 27992374, 30198788		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	17146292		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17989125, 25016932, 25347569, 25456951, 26456083, 26477313, 26637867, 27618325, 27880942, 29169802, 30301881		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	29365031, 35732329	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28399115, 29386109		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25316332	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24642468, 27758820		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	26608463	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	20467748	Associate	★☆☆☆☆ Found in Text Mining only
Angioblastic Meningioma	Angioblastic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Angioid Streaks	Angioid streaks	HPO_DG			★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	31290289, 32198016	Associate	★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	32422284	Associate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28578351, 35443723	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17483325, 25238546, 25673820, 26676747, 27145457, 27339327, 28454210, 29414775, 29896303, 30243721, 30404927, 30679163, 30814496, 30837243, 31452773		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	29952716	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	31589911		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	26617788		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35055064	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29872394		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	28415624, 36959563	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	CTD_human_DG	23308213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Disease	Aortic valve disease	Pubtator	23308213	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	23308213		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	16685399, 21437722, 23243208, 23500889, 25296973, 31636720		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	17468044		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	17669465		★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	21434579, 31094929		★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Mineralocortocoid excess	Pubtator	32355271	Associate	★☆☆☆☆ Found in Text Mining only
Argininosuccinic Aciduria	Argininosuccinic aciduria	Pubtator	31796844	Associate	★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	BEFREE	28286253, 31363831		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17255531, 18054314, 27919735, 28341552, 29588416, 29968072, 30915770, 31093976, 31177061, 31306371		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	30338819	Associate	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	35343049	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17599731, 30109356, 30954464		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	24385683, 37493406	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	36328206, 36994890	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34576119	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11465707, 15642134, 17665439, 19709444, 20187936, 21862580, 24294360, 26819496, 27391352, 27729613, 27860244, 28090093, 30402834, 31028998, 31338093, 32510258, 34753831, 35835748, 36661308, 37809066, 37904709, 38166916, 40190499	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	25649747		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28063403, 29207033, 29554934, 30146725, 30260006, 30406061, 30696844, 31747880		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30478434, 31412983, 34876240, 35069542, 36105239, 36354198, 37321621, 37904411, 40650018	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17146292, 17822324, 18177819, 19461960, 20569675, 23370326, 26286747, 29720957, 30344749		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18550470		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19573808, 20423999, 21113787, 26286747, 37280243	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	32937819	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	LHGDN	18413665		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19152963, 20842106, 22739265, 27821800, 35782055	Associate	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 1	Atelosteogenesis	Pubtator	35832491	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16269654, 17673673, 21070853, 24098801, 25110320, 27740938, 28341552, 29668625, 30915770, 32377692, 35463684, 37258122	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17255531, 18054314, 27919735, 28341552, 29588416, 29968072, 30915770, 31093976, 31177061, 31306371		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18458087		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30664154		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34841686, 36274100	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	29115618		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	16916907, 19351384, 21061022, 21900687	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19458356		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19458356		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	19898424		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	29296277, 31551593, 36401485	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29296277, 31007884, 31217543, 31551593		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22558359, 29296277		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22558359, 29296277, 33564861	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10950146, 24667640, 27312110, 29492193, 30692211		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27312110, 40141059	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	27099149	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	35778969	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	19176689		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	23023706		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	20064661		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	31534468		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	25979368, 29046392		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17375124		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20888662, 21315692, 23331925, 24811162, 25576220, 25862915, 25885794, 25964563, 26985864, 26987289, 28423593, 28447761, 28693262, 28992684, 29042957, 29099789, 29113186, 29250172, 29257286, 29285137, 29285175, 29286130, 29328384, 29363726, 29425176, 29434943, 29485914, 29488156, 29556279, 29570671, 29722086, 29774105, 29916538, 29928364, 29928421, 29956797, 30066948, 30106128, 30116377, 30178865, 30210588, 30211660, 30344696, 30477146, 30655858, 30783438, 30864701, 30942438, 31039387, 31115571, 31181779, 31239698, 31252679, 31547366, 31552178, 31618892		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	29709906, 30988120		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17559672, 30841855	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	27701407		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27701407	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23337888		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29456672, 29988032, 30295140, 30338790		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	29099866	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30089758		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	37108591	Associate	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	15150102		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	29024814, 30476750		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	28544747, 33289918	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	12618287, 19051289, 20214684, 22277669, 25726893, 29484683, 30038233, 30087257, 31810747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	12618287, 18466879, 19051289, 20214684, 22277669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	17825267, 18395980, 19051289, 20132317, 20214684, 25726893, 27701407, 29484683, 31810747, 33765445	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	21356374		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19802009, 19875696, 20354165, 22189542, 22285928, 22417847, 22525723, 22895070, 23300058, 23511556, 24122582, 25277204, 25349966, 25564356, 26148825, 26312564, 26375441, 28549468, 28889395, 29348843, 29383014, 29454321, 29463565, 29567231, 29702203, 30060954, 30066842, 30333873, 30515906, 30941989, 31278883, 31298367, 31605287, 31696468		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29436605, 30410927, 31163690, 39812346	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19648884, 25793716, 31769620, 36134117	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	26390436	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	23902739		★☆☆☆☆ Found in Text Mining only
Boomerang dysplasia	Boomerang dysplasia	Pubtator	35832491	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22277669		★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brachydactyly type C	Brachydactyly	BEFREE	15150102		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26345935, 28969385, 31639285, 36329890	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	31574956	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25418580, 36254861	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	18172656		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19573808, 20604919, 24133630, 24803579, 25269047, 25360740, 26410082, 26722465, 27694991, 33871399, 34499316	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21861842, 24141773, 27653874, 28292440, 31313988, 31540977		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Breast Carcinoma	Breast Carcinoma	BEFREE	10441522, 11429232, 12032855, 12244302, 12244303, 12569575, 12761490, 14681726, 14981538, 15710331, 15837735, 16049961, 16061647, 16144943, 16288304, 16537497, 16951146, 17308086, 17612563, 17804473, 17908967, 18676830, 18838536, 18937284, 19074894, 19418217, 20471940, 20591134, 20651350, 20664923, 21084382, 21203579, 21209903, 21406404, 21406469, 21425139, 21519185, 21574647, 21708937, 21730367, 22021428, 22060274, 22094188, 22177840, 22258408, 22488590, 22494103, 22552300, 22809628, 22875023, 22922893, 22938585, 23085752, 23092874, 23200933, 23237847, 23352210, 23499909, 23543364, 23643661, 23648148, 23675882, 23711387, 23814023, 23888070, 24269953, 24376685, 24403860, 24463007, 24470511, 24553191, 24628780, 24706460, 24957076, 25023728, 25071141, 25074979, 25108739, 25199759, 25283550, 25361981, 25422220, 25491778, 25702787, 25735723, 25816324, 25859923, 25869208, 25920913, 25928145, 25976617, 26095475, 26116361, 26170662, 26191181, 26194618, 26208487, 26267533, 26316122, 26351323, 26452060, 26540293, 26595803, 26631969, 26645663, 26666820, 26672755, 26676464, 26698305, 26758558, 26771843, 26845172, 26869349, 26895380, 26898459, 26945854, 26995633, 27004402, 27059323, 27113763, 27248326, 27292631, 27297869, 27341075, 27447121, 27447863, 27515171, 27563827, 27574028, 27608432, 27738081, 27771839, 27835884, 27853906, 27864123, 28117370, 28123607, 28183251, 28218907, 28287129, 28301567, 28381172, 28387904, 28388580, 28396252, 28418910, 28423521, 28423632, 28427202, 28443643, 28446508, 28459209, 28478612, 28487443, 28503860, 28513879, 28522609, 28530703, 28599470, 28627683, 28731146, 28779263, 28810530, 28853539, 28854595, 28874413, 28915591, 28916526, 28964785, 28969041, 29025596, 29055790, 29086897, 29088759, 29100327, 29103666, 29190947, 29202330, 29223745, 29262587, 29312549, 29476223, 29482551, 29506489, 29540052, 29556333, 29567542, 29625858, 29707142, 29736694, 29749454, 29808803, 29844859, 29925528, 29942081, 30008831, 30038508, 30038706, 30065942, 30087941, 30103105, 30104711, 30106443, 30122991, 30128822, 30135474, 30148117, 30154572, 30171053, 30175868, 30198810, 30266800, 30300626, 30320894, 30381079, 30385615, 30406874, 30426328, 30443181, 30445978, 30454896, 30464609, 30518851, 30552871, 30560942, 30578411, 30671946, 30720225, 30767161, 30774365, 30808745, 30845749, 30930461, 30993707, 31006103, 31007610, 31011573, 31092275, 31104012, 31182914, 31277699, 31281438, 31308741, 31320990, 31347059, 31359335, 31417306, 31448883, 31626273, 31669347, 31698236, 31746305, 31752925, 31761784, 31769593, 31771180, 31781306, 31827405, 31828441, 31844113		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10424760, 10441522, 10542266, 11870534, 12048182, 12105188, 12631397, 12771144, 12838322, 12853346, 12954616, 12972603, 14602723, 14631376, 14704150, 15121878, 15187102, 15367412, 15475931, 15504738, 15863513, 15905173, 15987444, 16168102, 16168105, 16168126, 16253990, 16280046, 16288304, 16341149, 16428439, 16504004, 16619501, 16755107, 16785234, 16859513, 16984917, 17088265, 17121430, 17189388, 17356711, 17428466, 17429139, 17545584, 17649772, 17690101, 17726467, 17804473, 18164268, 18184439, 18210742, 18262492, 18362935, 18386830, 18392055, 18423407, 18483465, 18519679, 18587642, 18625725, 18676830, 18725974, 18794113, 18822183, 18838536, 18922901, 18937284, 19074894, 19133231, 19324870, 19330798, 19395875, 19435893, 19435916, 19461960, 19573809, 19646290, 19655166, 19661335, 19706645, 19708779, 19800873, 19882362, 19889640, 19898424, 20042122, 20110378, 20157733, 20179196, 20228224, 20395207, 20444703, 20471474, 20471940, 20551062, 20649976, 20650008, 20664923, 20703095, 20712882, 20808831, 20836878, 20920193, 21050850, 21084382, 21112394, 21118977, 21127496, 21172654, 21198263, 21209903, 21278786, 21284537, 21406404, 21427355, 21487020, 21492444, 21546925, 21574647, 21708937, 21712253, 21726627, 21730367, 21811619, 21821931, 21869603, 21881167, 21897387, 21939528, 22117074, 22130369, 22132754, 22192357, 22270359, 22454081, 22460814, 22488590, 22494103, 22552288, 22689062, 22689141, 22740693, 22809628, 22842582, 22858377, 22935141, 22938585, 22957045, 23065768, 23085752, 23092874, 23226206, 23228483, 23242584, 23300741, 23389114, 23538857, 23543364, 23558942, 23570421, 23648148, 23786162, 23840605, 23848995, 23874830, 23929892, 23937725, 23981902, 23991038, 24122876, 24147022, 24163404, 24167614, 24335179, 24346768, 24359639, 24457069, 24467828, 24479521, 24498881, 24501006, 24568493, 24599585, 24618835, 24647156, 24714122, 24805814, 24869908, 24895461, 24903376, 24979463, 25108739, 25124606, 25159299, 25178514, 25216078, 25361981, 25488803, 25504433, 25613518, 25639875, 25702787, 25714853, 25734775, 25744065, 25816324, 25834401, 25854340, 25886003, 26026468, 26027929, 26181325, 26191181, 26192233, 26195282, 26208487, 26238439, 26247526, 26248960, 26260992, 26295469, 26316122, 26342198, 26451490, 26452060, 26462835, 26464650, 26474971, 26515727, 26521046, 26540293, 26608797, 26655502, 26662961, 26675309, 26698305, 26707081, 26752181, 26783290, 26810065, 26840401, 26845172, 26899600, 26915319, 26984519, 27028868, 27061264, 27081168, 27088857, 27094578, 27097161, 27184932, 27192118, 27197157, 27430308, 27447863, 27515171, 27624978, 27699665, 27708215, 27771839, 27806348, 27838413, 27853906, 27925203, 28027327, 28147277, 28176176, 28179017, 28198505, 28218907, 28247844, 28301567, 28320862, 28358430, 28387904, 28423632, 28446242, 28446508, 28459209, 28472036, 28478612, 28518139, 28522609, 28533273, 28636190, 28727815, 28827662, 28855026, 28874413, 28973975, 29054429, 29074537, 29103666, 29193730, 29229973, 29287594, 29316252, 29370782, 29373839, 29408595, 29438745, 29453318, 29453409, 29482551, 29524295, 29540052, 29549423, 29614107, 29614812, 29618179, 29620287, 29658179, 29691252, 29851245, 29863252, 29934528, 29949674, 29968965, 30024606, 30025446, 30050147, 30065942, 30076704, 30091186, 30140695, 30154572, 30196303, 30212483, 30212931, 30216645, 30286765, 30289335, 30343280, 30406874, 30420728, 30445978, 30483746, 30560466, 30652258, 30680659, 30744593, 30795784, 30808745, 30820547, 30845749, 30883028, 30930461, 31104012, 31109134, 31175550, 31257479, 31277699, 31317673, 31385461, 31547381, 31665227, 31688991, 31710162, 31771180, 31781306, 31799667, 31819016, 31883527, 31899608, 31924700, 31957838, 31976020, 31980423, 31980592, 32037484, 32053082, 32075106, 32088208, 32091409, 32207860, 32239160, 32271426, 32312891, 32355271, 32357920, 32377271, 32397063, 32541902, 32559179, 32620236, 32657393, 32669966, 32682817, 32704174, 32705168, 32710281, 32807213, 32811538, 32894276, 32945446, 33116033, 33146288, 33147101, 33159487, 33173974, 33219203, 33223203, 33224971, 33269821, 33303690, 33303839, 33311440, 33466512, 33571243, 33599863, 33669698, 33723724, 33772001, 33816619, 33854067, 33854152, 33861751, 33867824, 33899120, 33918814, 33947930, 34074257, 34075774, 34136934, 34191793, 34217266, 34221232, 34268930, 34408553, 34440755, 34464697, 34477239, 34499316, 34502165, 34503444, 34528694, 34556814, 34620747, 34643237, 34670536, 34677264, 34715882, 34762647, 34771123, 34837929, 34852177, 34873418, 34913074, 34983878, 35037412, 35069784, 35085258, 35122700, 35317849, 35322748, 35324524, 35345960, 35383130, 35414770, 35441778, 35461041, 35499128, 35610613, 35639264, 35649067, 35650627, 35668376, 35684480, 35732329, 35799892, 35880886, 35892586, 35896617, 35901340, 36011273, 36088502, 36115854, 36135836, 36193432, 36203222, 36233194, 36308067, 36309967, 36323740, 36329030, 36335375, 36362083, 36404682, 36454513, 36517818, 36550279, 36594100, 36633143, 36656380, 36692465, 36724120, 36882618, 36960852, 37004015, 37004031, 37059993, 37081542, 37108300, 37148752, 37175840, 37220224, 37394766, 37443749, 37474008, 37477531, 37480115, 37495687, 37501598, 37550275, 37556419, 37585411, 37664933, 37682166, 37736741, 37976368, 37988189, 38075552, 38101533, 38130932, 38231165, 38308220, 38412255, 38531793, 38553373, 39178760, 39300116, 39738797, 39769193, 39780215, 40038752, 40403210, 40481104, 40555003, 40597213, 40696656	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37209192	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Diseases	Bronchial disease	Pubtator	29749523	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	18154814		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	20348209, 22277669		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	36881552	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	29156644		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	16732486		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22241218, 22607709, 23603894, 26121143, 31300419, 31719683, 40021103	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	23603894, 26121143, 28619753, 29463831, 30333121, 30881494, 31719683		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	25238546, 28410220, 38354460	Associate	★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	39237660	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34162041	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	26499488		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	35265311, 37852997	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18386291, 20530556	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12011061, 12070140, 12373610, 12511591, 12917336, 15150572, 15184909, 15353558, 15743786, 15851405, 15920558, 16254112, 16861905, 17360667, 17481480, 17609269, 17996122, 18774962, 18790744, 18831514, 19199544, 19237633, 19814803, 19887755, 20173732, 20410674, 20530239, 20664599, 20712882, 20808831, 21050850, 21159649, 21172654, 21270601, 21667306, 21874010, 21935476, 22110663, 22146979, 22292935, 23152800, 23349696, 23449277, 23626817, 23786162, 24098937, 24133589, 24158497, 24161930, 24244612, 24423924, 24479521, 24498881, 24554664, 24669014, 24675677, 24970012, 25064845, 25116380, 25257795, 25607111, 25630670, 25889965, 25943311, 25944616, 26156586, 26225792, 26487493, 26515606, 26743283, 26894601, 27097161, 27494022, 27563096, 27589846, 27626683, 28097440, 28218907, 28363942, 28827662, 28967905, 29038421, 29259266, 29424922, 29470540, 29902261, 29968965, 30092789, 30536312, 31424653, 31638221, 31642198, 31688991, 31969492, 32218702, 32275841, 32512147, 32716350, 32810332, 32883234, 32962742, 33123313, 33147101, 33247671, 33296605, 33336613, 33452458, 33771982, 33911067, 34026291, 34344926, 34503444, 34546849, 34830011, 34921839, 34948236, 34954693, 35247260, 35394699, 35414782, 35440604, 35441778, 35592706, 35699794, 35712812, 35735430, 36000536, 36147467, 36644576, 36701842, 36869126, 37020036, 37025097, 37688978, 37997289, 38287309, 38565343, 39372720, 39556934, 40437613	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoid Tumor	Carcinoid tumor	Pubtator	19588205, 19651067, 23147412	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11551917	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11959846, 21113787, 25475127, 26502919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12727836, 17047397, 17639041, 18181165, 18351386, 18949358, 19418217, 20844931, 21317880, 22139084, 22705003, 22705004, 22748472, 23352210, 23400686, 24559118, 25426553, 25456951, 25912437, 27189341, 27334835, 27738081, 27873319, 27880728, 28231576, 28881794, 29506489, 30138565, 30941989, 31752936		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17669465, 37947157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12445202, 19055754, 22082146, 23435205, 28573224, 30178853, 31128046, 33972406, 36788083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	19898424, 20808831, 20836878	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20808831, 22689141, 28859163, 29848352, 30941989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	33377972	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10438468, 12679910, 12729898, 12896980, 16819163, 17609269, 17717605, 17996122, 18948272, 19261616, 19376776, 19445727, 21040406, 21512226, 21514425, 21545687, 21738655, 22108100, 22580126, 22581584, 22583868, 23035214, 23112878, 23383345, 23620780, 23658755, 23709421, 23874836, 23966163, 24103747, 24223153, 24232099, 24255131, 24317053, 24337632, 24346768, 24347489, 24375254, 24401154, 24425104, 24482231, 24556693, 24573607, 24616922, 24931142, 25087096, 25115442, 25120782, 25243186, 25424347, 25502685, 25537088, 25537506, 25633810, 25645159, 25647261, 25778319, 25943101, 25980493, 26000702, 26044564, 26045814, 26078356, 26165487, 26204832, 26287185, 26307067, 26381511, 26682007, 26708293, 26730736, 26901106, 26980196, 26992218, 27050147, 27172362, 27249599, 27389277, 27431384, 27519414, 27699664, 27779207, 27811373, 27821810, 27901475, 27918554, 28101574, 28240051, 28281971, 28284560, 28333142, 28347229, 28347248, 28442344, 28456666, 28560380, 28584306, 28655132, 28670683, 28713927, 28794477, 28810896, 28877210, 28975986, 28983625, 29048612, 29179215, 29208003, 29285854, 29321577, 29360760, 29361949, 29506532, 29603830, 29630107, 29749446, 29970718, 29991125, 29992971, 30025407, 30258464, 30291221, 30390677, 30418964, 30539857, 30663411, 30664155, 30685691, 30696802, 30720164, 30755064, 30761258, 30840267, 30940166, 31053086, 31132019, 31177062, 31196153, 31203308, 31281549, 31298047, 31364110, 31406102, 31426282, 31476254, 31477445, 31524260, 31545468, 31638175, 31684995, 31698564, 31698701, 31754332, 31796646, 31796844, 31841454, 31842909, 31860631, 31878795, 31931758, 31988091, 32016465, 32024555, 32059741, 32100006, 32184568, 32196585, 32197467, 32236628, 32271415, 32298608, 32319540, 32376896, 32377744, 32394474, 32417759, 32466169, 32633354, 32677672, 32681102, 32700738, 32829570, 32871766, 32910747, 32934298, 33000250, 33097695, 33155364, 33289700, 33293585, 33436534, 33511213, 33523562, 33621431, 33660795, 33684566, 33760124, 33772101, 33816616, 33846786, 33860125, 33902004, 33982772, 34050704, 34076140, 34108451, 34148029, 34217312, 34271243, 34366628, 34408201, 34410900, 34418326, 34443536, 34445353, 34445559, 34522186, 34559939, 34570663, 34639072, 34657150, 34761605, 34803509, 34903711, 35007301, 35038357, 35046108, 35075389, 35092191, 35127170, 35151320, 35169125, 35196550, 35236826, 35238236, 35238496, 35291486, 35293266, 35306563, 35313850, 35313929, 35383533, 35394699, 35414782, 35426224, 35449837, 35547764, 35562734, 35592706, 35602902, 35610614, 35647179, 35655254, 35712812, 35719058, 35720901, 35769514, 35840921, 35861040, 35909586, 35955931, 35958019, 35977595, 36031387, 36062301, 36147467, 36157928, 36232606, 36274132, 36310384, 36317061, 36351994, 36374212, 36416062, 36439183, 36445845, 36458010, 36575044, 36578460, 36588796, 36609600, 36698167, 36894454, 36911723, 36920600, 36973424, 37005078, 37008632, 37132043, 37211171, 37212524, 37547758, 37573318, 37633911, 38168113, 38177295, 38279869, 38287824, 39183055, 39529637, 39930826, 40158165, 40424306, 40544497	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24840867, 32281236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16341149	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	19898424, 26718977	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	30793508, 30978501, 35331190	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26451490, 31018945, 32661241	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	22261808, 22363598, 26743471, 37311987	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	29419396, 33479203	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19802009, 19875696, 20354165, 22189542, 22285928, 22417847, 22525723, 22895070, 23300058, 23511556, 24122582, 25277204, 25349966, 25564356, 26148825, 26312564, 26375441, 28549468, 28889395, 29348843, 29383014, 29463565, 29567231, 29702203, 30060954, 30066842, 30333873, 30515906, 30941989, 31278883, 31298367, 31605287, 31696468		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28713931, 29085504, 29299828, 29312563		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17613432, 18256540, 18391978, 18559520, 18566221, 18644989, 18852117, 19337377, 19501140, 20447721, 20885957, 20959404, 21182834, 21333374, 21688263, 21716144, 21911043, 21996732, 22313637, 22941571, 23319332, 23824739, 24469108, 24596211, 24659658, 24789704, 24998847, 25066607, 25448566, 25653196, 25687876, 25697899, 25738369, 25862855, 25880371, 26053093, 26234648, 26573869, 26645682, 26654940, 26676756, 26678031, 27050278, 27189341, 27422710, 27431918, 27452907, 27682214, 28218907, 28285180, 28436990, 28454237, 28662101, 28714963, 28716898, 28849122, 28901268, 29151965, 29207183, 29501727, 29568927, 29606701, 29620222, 29712908, 29770473, 29916527, 30112033, 30365050, 30390072, 30431081, 30481052, 30485528, 30510432, 30546837, 30732751, 30864724, 31074646, 31415720, 31467180, 31748336		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19240722, 19765303, 20661217, 23545606, 23708104, 24816687, 25307974, 25359618, 26261554, 26423401, 26716408, 26823830, 27118139, 27465688, 29996940, 31062766, 31173282, 31234823, 31581131, 33475035, 34071938, 34445495, 36801818	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18254976, 23437362, 25079376, 25120759, 25238546, 25905463, 26219899, 27230035, 28061880, 29526843, 30206226, 31731384, 32375296, 33051432, 34771150, 35327583, 35457111, 35699794, 36536047, 38037549, 40317966	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11551917, 15851405, 18283322, 18774962, 19061835, 19118035, 21269758, 21350947, 21644050, 21881486, 22950635, 22991494, 23139422, 23219378, 23433103, 23792604, 23824745, 23981302, 24119769, 24175769, 24576174, 24797175, 24802662, 25588050, 25757764, 25784113, 25954860, 25973014, 26018509, 26224474, 26261493, 26537074, 26790128, 27174587, 27223432, 27279483, 27387559, 27662590, 27812180, 28029662, 28412750, 28691643, 28849086, 29017559, 29357836, 29754934, 29984342, 30016766, 30032137, 30048489, 30368665, 31431792, 31485634, 31542232, 31702026, 31743108, 31900208, 32009115, 32229735, 32279409, 32305558, 32496306, 32964964, 32990143, 33924053, 34002003, 34257606, 34337864, 34346740, 34490473, 34581421, 34699322, 34790278, 35305660, 35508649, 35696242, 35982911, 35996134, 36117171, 36176934, 36214716, 36313180, 36429034, 36674979, 36852468, 37024452, 37033923, 37642220, 37674204, 37749865, 38008826, 38588851, 39233640, 39768828, 39910585, 40081509	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	24980293, 25855050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15289499, 15920558, 19484147, 19625778, 21068757, 21407808, 22626691, 23196793, 24659658, 25426553, 25813410, 25855050, 26030731, 26080840, 26992219, 27884700, 28438789, 29902261, 29980281, 30318447, 30978501, 31035650, 31049937, 31551362, 32281236, 33236153, 33444335, 33865336, 34263914, 34299042, 35137520, 35186067, 36085041, 36357817, 36897548, 37347115, 37746966, 38084139, 38299232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20557351, 24449057, 30675221		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	26087898		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15806173, 17178867, 17377809, 19151754, 19240722, 19621391, 19638206, 20661229, 22306204, 22328975, 23408974, 23591839, 23680521, 23869765, 24115647, 24815691, 25176450, 25216292, 25281495, 25307974, 25337238, 25359618, 25405658, 25677064, 26023849, 27465688, 27811362, 27935869, 28664915, 28983627, 29286125, 29401696, 29461589, 29685168, 29996940, 30129654, 30245957, 30515820, 30620384, 30672020, 30972187, 31006841, 31128298, 31163640, 31210292, 31284467, 31639424, 31820522		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19389926, 28193280	Associate	★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	29158583	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	17198778, 36046382	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	23044536		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	24448315		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	32460327, 35741813, 36435742	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	24448315		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	12796566, 25708222	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16075055		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27780169, 28695302, 29734265, 30132505		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	30941910		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26488172, 27740938, 28157227, 35908957	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29109781, 29275936		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30927912		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	23460186, 24385683, 30569095, 32052902, 32322000, 37006311, 37493406	Associate	★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	25782637		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31178586, 31685084		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31178586, 35179404	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	22785229	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29486290		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	17506723	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Convexity Meningioma	Cerebral Convexity Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36169245	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29290948, 30074018, 31389591, 31836786		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33778069	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	33184298	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29336875, 31127489		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	25849550	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165, 23899375, 25962638, 26183061, 29130111, 29225475, 29236322, 29800735, 29898430, 30480801, 30710498, 30808417, 31056260, 31075090, 31210295, 31333726, 31729992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165, 22179829, 23899375, 25962638, 26183061, 29130111, 29225475, 29236322, 29800735, 29898430, 30480801, 30710498, 30808417, 31056260, 31075090, 31210295, 31333726, 31729992		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27717743, 27725691, 30669372, 30688831		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30112810		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	12060623, 16707597, 19887560, 21861842, 24300787, 25601471, 27012813, 28159923, 28650469, 29682173, 30050750, 30244244, 30670636		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15150102, 15940637, 16767220, 17461449, 21354147, 22735632, 22875246, 24892809, 26260613, 29221199, 29251327, 29387222, 29428513, 30400838, 30450012, 31835877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15855163, 17461449, 19147772, 19445727, 20012722, 20731018, 21874010, 23832540, 24757411, 26014518, 26260613, 26296968, 26823715, 27206490, 28178656, 28694672, 29915392, 30359740, 30400838, 30920845, 31638221, 31754244, 33017884, 33535978, 35070505, 35550144, 36676763, 37164714, 37198696, 37324940, 37369494, 37486965	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17461449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29191461		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	35196362	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	24311896, 29559833, 34400892, 34522167, 34664835	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	31663994		★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	24311896, 34400892	Associate	★☆☆☆☆ Found in Text Mining only
Chondroma	Chordoma	Pubtator	28410203	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18720410		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23320110, 23874483, 23922104, 26168133	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	23922104		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Mesenchymal	Chondrosarcoma	Pubtator	35342947	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	19276265, 19401700, 26823799, 32011476	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	19401700, 23618355, 30426615		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	27171670, 27922982, 28259870, 31851527		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34220309	Associate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29137981		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30607007		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18665177, 23482887, 24825182, 25430416, 25804768, 25917267, 26821067, 26889681, 27815263, 28731148, 29191916, 29262536, 29916761, 30648436, 30669372, 30988120, 31203134, 31216925		★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	19880494		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	23748344, 24290217, 29946821, 30570876, 30730307		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28578881, 29680737		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	31663994		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31351582	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27173130		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	23028762	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19054267		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	24448315		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	18949358		★☆☆☆☆ Found in Text Mining only
Clear Cell Meningioma	Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	23824745, 30774762		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35693826	Associate	★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	31485183		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21187413, 21788944, 29290948, 31685977		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21775978, 21788944, 22525159, 23095849, 28050343, 30611996, 33765445, 36229517	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23095849, 38039290	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29482156, 30385297, 30971761, 31534619		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18045591	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33299870, 33432986, 35733095, 35966251, 36860851, 37960728, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	15150102		★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16202996, 18283336, 19461960, 20332435, 21425139, 22728329, 23629727, 23881925, 24338765, 25745998, 25873394, 25889965, 26352871, 26471487, 27191497, 27277835, 27878243, 28082369, 28675857, 28739729, 28901472, 28972559, 29130099, 29273065, 29344654, 29364475, 29662189, 30013659, 30338799, 30387805, 30518879, 30788662, 31039290, 31168297, 31186741, 31348616, 31502038, 31524255, 31596887, 31772677		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11756242, 31830892		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12417326, 16128748, 21722370, 25031754, 25301365, 25556496, 28811711, 30003723, 30683109, 33028966, 34477047, 35707003	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16912864, 17478078, 17599831, 18451140		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11756242, 15592509, 15888491, 17149612, 17590872, 18193083, 18813315, 19351759, 19491830, 19700418, 20130434, 20595063, 21199803, 21412012, 21425139, 22830422, 22982087, 23251002, 23604118, 23934607, 24000138, 24182354, 24189753, 24619662, 24666267, 24845030, 25365190, 25374184, 25450577, 25613817, 25683705, 25714871, 25800793, 25917796, 25920435, 26045788, 26159723, 26224873, 26238857, 26377365, 26398368, 26690310, 26741506, 27296289, 27350731, 27562229, 27634156, 27901475, 27913571, 27999210, 28002807, 28081222, 28107519, 28139498, 28153010, 28230287, 28300833, 28322462, 28339062, 28412748, 28422727, 28427191, 28584719, 28677721, 28708103, 28729699, 28745498, 28767179, 28771881, 28884839, 29023587, 29048669, 29050940, 29097259, 29118671, 29207091, 29207180, 29221726, 29222171, 29339153, 29344262, 29383839, 29422975, 29441725, 29552187, 29553945, 29767249, 29781037, 29901203, 29921293, 30038258, 30076720, 30147336, 30188700, 30217479, 30262880, 30410397, 30417481, 30483811, 30636581, 30639585, 30662801, 30719773, 30738693, 30744692, 30854093, 30857973, 30858154, 30896866, 30983885, 31118579, 31164625, 31196027, 31259992, 31272064, 31322251, 31357480, 31380280, 31423282, 31435638, 31506897, 31704733		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GENOMICS_ENGLAND_DG	23246288		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12115344, 12140294, 15808505, 15970687, 16475687, 17276526, 17278192, 17640974, 18064605, 18283336, 18805444, 18931700, 19056378, 19351759, 19505918, 19596916, 19797085, 19997600, 20020129, 20053782, 20233444, 20332435, 20421047, 20546605, 20595063, 20622004, 21102582, 21209368, 21425139, 21430067, 21464950, 21713600, 22285861, 22490361, 22554284, 22581840, 22710713, 22830422, 23363659, 23392169, 23431386, 23624914, 23725225, 23732517, 23737956, 23743569, 23886157, 23992303, 24069372, 24151146, 24205104, 24312276, 24338765, 24619078, 24685694, 24724981, 24760019, 24845030, 24905002, 24930890, 24936148, 24940619, 24960186, 24970012, 25031754, 25085593, 25122478, 25196260, 25374184, 25409929, 25613817, 25637165, 25714871, 25749388, 25791293, 25880142, 25889965, 25945841, 26071104, 26077911, 26098881, 26191138, 26452029, 26631035, 26632346, 26690310, 26693911, 26729093, 26787540, 26797410, 26988990, 27057280, 27058759, 27095166, 27098148, 27156963, 27296289, 27323826, 27350731, 27391062, 27435399, 27562229, 27644693, 27661110, 27859949, 27874952, 27878243, 27901475, 28002807, 28013491, 28107519, 28139498, 28281964, 28300833, 28412748, 28453235, 28454566, 28507280, 28624786, 28653875, 28729699, 28739729, 28771224, 28803443, 28811711, 28835319, 28837154, 28972559, 28990068, 29023587, 29068474, 29138025, 29186710, 29307989, 29383839, 29393377, 29441725, 29471888, 29483812, 29740162, 29745074, 29770434, 29921474, 29970892, 30025541, 30228782, 30243491, 30262880, 30338799, 30365116, 30403183, 30468657, 30476901, 30618098, 30658502, 30683109, 30683840, 30721393, 30744692, 30841414, 30842340, 30853664, 30854932, 30873717, 30896866, 30896869, 30941959, 30942436, 30947633, 30985693, 30985981, 31002129, 31017126, 31118579, 31125260, 31164625, 31253108, 31322251, 31435638, 31500630, 31502038, 31548566, 31704733, 31736063, 31781361, 31781676, 31782259, 31802830, 31839745, 31847370, 31852293, 31972222, 32000660, 32020212, 32203206, 32209726, 32323816, 32331534, 32370786, 32373957, 32385195, 32388500, 32495637, 32533590, 32580297, 32601379, 32631392, 32701605, 32703189, 32764874, 32962206, 32990415, 33016643, 33090398, 33092235, 33179291, 33208845, 33233823, 33238770, 33247671, 33296605, 33345684, 33445526, 33554313, 33564344, 33649853, 33720534, 33721478, 34165158, 34193174, 34219464, 34320120, 34395609, 34512817, 34560542, 34638550, 34889713, 34931923, 34997428, 35053185, 35067161, 35110545, 35110552, 35126924, 35163215, 35191517, 35208943, 35216429, 35236827, 35416128, 35440604, 35506454, 35536149, 35544729, 35545369, 35595748, 35633908, 35638907, 35639036, 35655161, 35810694, 35907820, 35924235, 35944058, 35962953, 35978873, 35983971, 36030982, 36033553, 36073574, 36135759, 36147460, 36202073, 36221415, 36232922, 36242053, 36264073, 36303457, 36348305, 36385303, 36453240, 36465266, 36497132, 36500365, 36651426, 36675180, 36696241, 36793126, 36862005, 36899368, 36982429, 37083591, 37086961, 37100467, 37144998, 37147883, 37227305, 37264959, 37286729, 37430297, 37639911, 37640741, 37658050, 37821801, 37929348, 37945707, 38167930, 38364976, 38556263, 39275334, 40004112, 40075273	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	15183529, 19731079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15888491, 16202996, 16278380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23573286	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	35638907	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32961022	Associate	★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	29296277	Associate	★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	28818232		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	25722288		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of neck	Congenital Anomaly Of Neck	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28530660, 29976569		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	23308213	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	32054096	Associate	★☆☆☆☆ Found in Text Mining only
Congenital bronchogenic cyst	Congenital Bronchogenic Cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16715125, 25322685		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21325635, 22810956, 25580681, 26015398, 26313366, 26657242, 29221199, 29387222, 30308494, 30316146, 31456644		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30260286		★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Lipomatous Overgrowth Vascular Malformations and Epidermal Nevi	Congenital lipomatous overgrowth, vascular malformations, and epidermal nevi	Pubtator	28502725, 34074347	Associate	★☆☆☆☆ Found in Text Mining only
Congenital macrodactylia	Congenital macrodactylia	BEFREE	23100325		★☆☆☆☆ Found in Text Mining only
Congenital macrodactylia	Congenital macrodactylia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Microtia	Congenital microtia	Pubtator	35346221	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	26193632, 28073911		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pontocerebellar hypoplasia	Pontoneocerebellar hypoplasia	BEFREE	23793931		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17885560, 26034202, 27249321, 28112209, 29358197, 30257319, 30542471, 30974752		★☆☆☆☆ Found in Text Mining only
Conjunctival hamartoma	Conjunctival hamartoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18243508, 21644050, 23086777, 23824745, 24448243, 25528216, 25623744, 25757764, 26537074, 27283897, 27412013, 27498834, 27844272, 28114284, 28691643, 29148041, 29158991, 29228653, 29228703, 30032137, 30594602, 30655739, 30723697, 30777326, 31139560, 31545251, 31832810		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	30991049		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	24064688	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30984553		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	24490960	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18054314, 31377586, 31594751		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18054314		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31886261	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35801781	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33849106, 35866783, 38013355	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18054314		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	28969385		★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	19035362		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	32131410, 34872267, 35866040	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	39465738	Inhibit	★☆☆☆☆ Found in Text Mining only
Cowden syndrome	Cowden Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COWDEN SYNDROME 6	Cowden Syndrome	GENOMICS_ENGLAND_DG	23246288		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COWDEN SYNDROME 6	Cowden Syndrome	UNIPROT_DG	23246288		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COWDEN SYNDROME 6	Cowden Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COWDEN SYNDROME 6	Cowden Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Craniosynostoses	Craniosynostosis	Pubtator	23073384, 35285136	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	21483870	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18045591	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28659381		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30396963, 31535400		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28213469, 31813753		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	28794469, 31664087, 32630830	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31813753	Inhibit	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27669541, 28320092, 28931211, 29093428, 29323710, 29434702, 29435116, 29693122, 29899865, 30248539, 30335903, 30500068, 30776646, 30938722, 31652455		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29677563		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22575597, 30457077		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	32471155	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	36451386	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21315744, 23188793, 23240760, 23972212, 24022875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	22094188, 24022875, 25726893, 26515520, 31477683, 31618892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	25726893	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	30196309, 31104012, 31477683, 37745719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	39312335	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27913303		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	23922674	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	27676325, 29088769		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29296277, 37501076	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23880101, 28477532, 29122977, 29805536, 29953446, 30816444, 30919366, 31001672, 31078742, 31222481, 31537300		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35757473, 35993048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22808198, 26302821, 28400911, 29298529, 35449053, 38497391	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11782951, 23880101, 26465605, 28477532, 29122977, 29805536, 29953446, 30206697, 30477146, 30816444, 30919366, 31001672, 31078742, 31222481, 31537300, 31539141		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16139132, 16339764, 20346323, 21521253, 21606676, 23862686, 23874686, 24255036, 24521217, 26683100, 27401534, 28157504, 29768267, 32600435, 35288456, 35956419, 35993048, 37522815, 38027137	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24797175, 35628588	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19654878, 28239651, 35784577, 36303457, 37468555, 39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18395980, 21460183, 23344726, 23369358, 26178916, 26269521, 26386696, 28012244, 29768267, 30992506, 31332162, 32705173, 33788629, 34740995, 35046895, 37680885, 37734146, 37935955, 37986298, 38027137, 39275851	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30651870, 30973884		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11508278, 18395980, 19581418, 21664164, 22155243, 26178916, 26643367, 28225806, 28431241, 28477532, 28732797, 29680463, 29693163, 29696964, 29768267, 30210342, 30263000, 30378162, 30773997, 30928787, 31087709, 31108940, 31609623, 31648709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	17566113		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	33537821	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28290552, 30132505		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	33909697	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24797175, 34840704, 36181090, 37063851, 38374020, 40312440	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26465605, 28427241, 29031207, 29246323, 30263007, 30652342, 30864227, 30988734, 31032350, 31489995, 31539141, 31668144		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	29533535		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	21686327, 25695094, 31432194, 35590353, 36465659, 38194422, 39348384	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29104476, 31566891, 31593688, 31702490, 31702491, 31759996		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28489509, 32312891	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	19887755	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	28189993, 29207163		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15331441, 18382359, 19036086, 20443680, 21742807, 22609116, 23580656, 23636313, 23764004, 23840064, 24418330, 25909227, 26585955, 26823817, 27348272, 27448819, 27720936, 28202458, 28627414, 28639315, 29734016, 30165192, 30881494, 31123343, 31684984, 31775867, 31831562		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	37872602	Associate	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	29259266	Associate	★☆☆☆☆ Found in Text Mining only
Dissection Ascending Aorta	Dissection of aorta	Pubtator	34346740	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	26968811	Inhibit	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	20059950, 23380710, 24735980, 25701644, 34200970, 35222360	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23380710, 30176349, 30410750		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	17549359		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	19898424, 23352210		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	33577028	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	26018562	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium syndrome	Pubtator	36635778	Associate	★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27658743		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35899893	Associate	★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	22688921, 30184529		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	39424480	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	25701704		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27913303		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	24793135		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24467828, 26666173, 28874413, 30515568, 31710162, 33466512, 33816619	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	27305487, 28222424, 29898896		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11309338, 11497285, 15505622, 16273242, 16580307, 17471559, 17924977, 18615621, 19234438, 19491896, 19853286, 19917135, 20173732, 20664599, 20855612, 21093899, 21495229, 21760855, 21952748, 22146979, 22662154, 22846840, 22911820, 23028188, 23142288, 23174537, 23280503, 23943160, 24366110, 24561032, 25068805, 25118299, 25141911, 25534488, 26296520, 26572704, 26734994, 27259051, 27550940, 27572308, 27910071, 28098854, 28112582, 28179296, 28202507, 28427207, 28860563, 28886696, 29080395, 29182407, 29257334, 29595187, 29745433, 30021163, 30154548, 30298385, 30319275, 30338797, 30344696, 30402135, 30431102, 30442683, 30574817, 30779215, 30853360, 30936746, 31192127, 31201812, 31486482, 31588998, 31623857, 31781484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	GWASCAT_DG	27135401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	19631369, 31452406	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12888921, 16012720, 17924977		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15016316, 15505622, 17150964, 17213663, 17924977, 18096667, 18615621, 19056846, 19107520, 19154413, 19234438, 19491896, 19775474, 19917135, 20087603, 20173732, 20218740, 20664599, 21093899, 21228924, 21760855, 21816851, 21846689, 22146979, 23028188, 23280503, 23702729, 23922669, 23943160, 24817931, 25487944, 25640355, 25720322, 26033187, 26193427, 26825822, 27259051, 27572308, 28427207, 28476021, 28886696, 29080395, 29081412, 29182407, 29449346, 29595187, 29762822, 29799481, 29949146, 30610803, 30816518, 30840303, 31131636, 31168597, 31452406, 31527078, 31545414, 31637941, 31863623, 32020231, 32107418, 32431202, 32908897, 33577023, 34278450, 34337010, 34670536, 34831139, 35404759, 35734366, 35805203, 36434592, 36483599, 36916001, 37567170, 37730563, 37737665	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	22072736, 24064688		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19055724, 19074548, 22072736, 24064688, 24133578, 25194152, 31144476, 31273584, 31637941, 35401535, 38146657, 38364342, 39768828	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19429661, 22072736, 24036443, 24064688, 26572704, 26899323, 29457968, 30515820, 30578826, 31547870, 31637941		★☆☆☆☆ Found in Text Mining only
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	36591238	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	26523971		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	20064661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	25722288, 26345935, 26961412, 27838154, 29399113, 31563029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	26345935	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	27838154	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	26537625	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	29331082	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	20064661		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30243822		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29215110, 31625572		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19151754, 19240722, 19621391, 19638206, 22306204, 23680521, 25281495, 25405658, 26023849, 27465688, 27811362, 27935869, 29286125, 29685168, 29996940, 31006841, 31163640		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11959846		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	25377560		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29174980, 30477146		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17342332, 17974918, 25912437, 26302489, 27239113, 29530788, 29604392, 29709473, 30636576, 31267531		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10908564, 19164214, 21467840, 24241346, 25211657, 26000878, 26050229, 26124180, 26317790, 26647768, 26828791, 27188433, 27239113, 27781415, 28548104, 28631572, 28899457, 30058693, 30098109, 30178844, 30368517, 30758105, 30942438, 31669361, 31810385, 32208405, 32225025, 32360515, 32811869, 32985648, 33484472, 34057012, 34969363, 36070107, 39375680	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17342332, 17974918, 25912437, 26302489, 27239113, 29530788, 29604392, 29709473, 30636576, 31267531		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18425364		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21467840, 21689625, 21986133, 23114644, 25730371, 26191164, 26338103, 26828791, 27902974, 29463194, 29620226, 29867084, 30594787, 31558183, 31669361, 31810385, 32330901, 32377720, 32457351, 33061807, 33311557, 33321911, 33460563, 34190001, 34224333, 34841952, 34954212, 35238170, 35662041, 35904643, 36335371, 36870981, 36995521, 37083097, 37879503, 38043670, 39596630	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38320632	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	30570876	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17028919, 23536552, 27259270, 30926641		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	28489509, 31277699, 32312891, 33377972	Associate	★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	17915974		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14636889		★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	31614935	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	26910913, 29223420, 29416661		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	31759091	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	29367738, 35013040, 35288456	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	29534306, 31604805, 31712058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	37223041	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662, 30248539		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	30287501		★☆☆☆☆ Found in Text Mining only
Fibroadenoma of breast	Fibroadenoma Of Breast	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	27062580		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	27577794		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	26626406		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28371611, 31213776, 31755616		★☆☆☆☆ Found in Text Mining only
Fibrous Meningioma	Fibrous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Fibrous skin tumor of tuberous sclerosis	Adenoma sebaceum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	15455398, 26961412, 30048676		★☆☆☆☆ Found in Text Mining only
FNAITP	Fetal and neonatal alloimmune thrombocytopenia	BEFREE	25774504		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	15455398, 25722288		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	25722288, 32785072	Associate	★☆☆☆☆ Found in Text Mining only
FOCAL CORTICAL DYSPLASIA OF TAYLOR	Focal cortical dysplasia	BEFREE	26345935, 31337748		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	26345935	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18055323, 18480379, 20001715, 27618325		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	24563264		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	25363469	Associate	★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26294099, 26947513, 28412732, 28766687, 29413947, 29416013, 31411121		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24551272, 26287365, 26910892, 31752906, 34118139, 34184087, 35196196, 36546234	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26818920, 29512701		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	26317520	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	26317520		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	17330838, 36906972	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	21042278		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	21042278, 25031754, 32863943, 35705314	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	28777148		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	15837988, 16461335, 16707477, 17122634, 17909012, 18550829, 19860642, 20023270, 20043176, 23231951, 24706111, 25757539, 25898773, 27370604, 28442505, 30551450, 31776458		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	16707477, 18521081, 18550829, 25898773, 27469332, 29902839, 30537795, 30551450, 30887595, 31553483, 33266502, 34738628, 36921738, 36966336	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	17546049		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	19641183, 19965620, 22922206, 25907832, 32321919	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	24277456		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	29710674		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	33994368	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516, 33934404	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29421576, 31680442		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	31680442	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	26788026		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10940516, 10945642, 10958682, 15782140, 16007122, 16150119, 16923165, 17047065, 17122647, 17146292, 18566746, 19461960, 21454539, 21827416, 21861842, 22004682, 22337773, 22391209, 22745588, 23298478, 23448150, 23555046, 24036851, 24984002, 25200832, 25213694, 25256166, 25326893, 25501279, 25662849, 25724300, 26536004, 26561558, 26608373, 27419830, 27422127, 27553832, 27568206, 27593939, 27783537, 28160553, 28260004, 28320338, 28445937, 28576488, 28616662, 28696243, 29038421, 29048626, 29088769, 29089868, 29113309, 29328424, 29355710, 29434887, 29444745, 29467947, 29729901, 29866190, 29945963, 29980193, 30037819, 30092165, 30116397, 30144594, 30312846, 30357833, 30420967, 30531692, 30613151, 30662577, 30731398, 30816477, 30856536, 30917320, 31000415, 31081099, 31088402, 31117874, 31243804, 31325145, 31376551, 31402948, 31470874, 31541850, 31618458, 31695152, 31771104, 9799739		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11756412, 14655756, 14701753, 15605984, 15808505, 16199861, 16740698, 16923165, 17002787, 17513297, 17697526, 18567800, 18804099, 19458076, 19461960, 19587783, 19775291, 19828040, 19861406, 20167810, 20484045, 21408136, 21471286, 21804599, 22077956, 22125077, 22145100, 22156546, 22337773, 22450747, 22497886, 23166678, 23190603, 23409016, 23677714, 23822711, 24048798, 24265816, 24378652, 24518591, 24759784, 24771221, 24867100, 24984002, 25197356, 25256166, 25257795, 25366337, 25501279, 25501707, 25719943, 25793261, 25835975, 25913706, 26097540, 26125228, 26286747, 26299938, 26345416, 26473829, 26490252, 26536004, 26608373, 26936801, 27177902, 27210502, 27422127, 27789731, 28051998, 28303930, 28320338, 28341744, 28445937, 28834297, 28837676, 29038421, 29321087, 29444745, 29754406, 29901201, 29941152, 30129426, 30351133, 30353649, 30531692, 30760837, 30943918, 30991141, 31000415, 31081099, 31844979, 31905344, 32005873, 32020210, 32060308, 32231148, 32236901, 32337956, 32705169, 32860048, 33318517, 33588605, 33762574, 33763472, 34768941, 34784707, 34831287, 35087132, 35163067, 35368876, 35513291, 35538679, 35637600, 35741006, 35857445, 35977996, 36076555, 36077559, 36168628, 36234681, 36580003, 37247274, 37309294, 37365560, 37594082, 37728571, 37757768, 37997289, 38068712, 38368287, 38376284, 38385470, 39206901, 40133683	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16818690, 17513297, 18550470		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10940516, 10945642, 10958682, 15782140, 16007122, 16923165, 17002787, 17047065, 17122647, 17146292, 18566746, 19461960, 19724909, 21827416, 21861842, 22004682, 22337773, 22391209, 22745588, 23298478, 23448150, 23555046, 24036851, 24352760, 24984002, 25200832, 25213694, 25256166, 25326893, 25501279, 25662849, 25724300, 26481529, 26536004, 26561558, 26608373, 27419830, 27422127, 27553832, 27568206, 27593939, 27783537, 28160553, 28260004, 28320338, 28445937, 28486630, 28576488, 28616662, 28696243, 29038421, 29048626, 29088769, 29089868, 29113309, 29328424, 29355710, 29434887, 29444745, 29467947, 29535541, 29729901, 29866190, 29945963, 29980193, 30037819, 30092165, 30116397, 30144594, 30312846, 30357833, 30420967, 30531692, 30613151, 30662577, 30731398, 30816477, 30856536, 30917320, 31081099, 31088402, 31117874, 31214505, 31243804, 31325145, 31376551, 31402948, 31470874, 31485609, 31541850, 31618458, 31695152, 31707687, 31771104, 9799739		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12388552, 15184909, 15197348, 15711939, 16103081, 16461357, 16530701, 17360667, 19048112, 19176518, 19252415, 19543319, 19661320, 19671762, 19705067, 19827268, 19861406, 19894763, 20499402, 20607350, 21072054, 21460616, 22076676, 22093097, 22753230, 22821383, 23298478, 23865743, 23866847, 24041957, 24740456, 24741074, 24771584, 24913705, 24984002, 25152024, 25257795, 25273058, 25394492, 25532840, 25823655, 25833462, 25854175, 25860846, 26044191, 26151295, 26378521, 26473829, 26559543, 26617839, 26718891, 27177902, 27248469, 27306214, 27422127, 27613837, 27633132, 27789731, 27802437, 27869735, 27926990, 28208619, 28410531, 28506595, 28765641, 28784180, 28887597, 28990104, 29316313, 29328863, 29579036, 29667783, 29805974, 29866190, 30015880, 30016785, 30048971, 30111766, 30186853, 30296359, 30338804, 30353649, 30403311, 30420967, 30542720, 30636076, 30657567, 30784920, 31002138, 31081101, 31171914, 31187466, 31307224, 31355268, 31593589, 31794427, 31858726, 31875760, 31983121, 32329858, 32419643, 32627020, 32735016, 32796700, 32902145, 32962742, 33029523, 33099953, 33125147, 33150178, 33268783, 33369441, 33557829, 33621203, 33637977, 33676540, 33706561, 33876384, 34056009, 34068110, 34100771, 34102393, 34106407, 34281455, 34798125, 34887392, 34913078, 35100091, 35287169, 35637600, 35981653, 36552854, 36708044, 36795994, 36799154, 36852158, 36944954, 36999945, 37101376, 37194413, 37796789, 37980651, 37994157, 38065968, 38569452, 39348350, 39684661, 39780215, 40332526, 40495644, 40656950	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15557754, 17041888, 19861406, 20167810, 20499402, 20533335, 20888802, 21057530, 21720709, 21827416, 21842313, 22179124, 23338526, 25351348, 25597410, 25761777, 25833462, 25854175, 26617742, 27108836, 27840895, 28035748, 28292440, 28410531, 28498444, 28608562, 28616662, 28677773, 28679777, 28696243, 28791407, 29207186, 29228741, 29282077, 29316313, 29535541, 29774498, 29804240, 29997438, 30111766, 30372896, 30420967, 30553445, 30660646, 30856536, 31002138, 31171769, 31171914, 31214505, 31226483, 31345225, 31378903, 31591377, 31605296, 31776938		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17041888, 17235455		★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	14655756		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	14655756, 28193280, 34856571	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29296277		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	20485333, 27730700	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	28925480		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	27717743		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	31318944	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	31941945	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	BEFREE	30461220		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	38033740	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	36123941	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	8879195	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	26137586, 26362254		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24840811		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	24840811, 37859983	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	23092922, 31622470, 33488522, 34269815, 39619202	Associate	★☆☆☆☆ Found in Text Mining only
Gynandroblastoma	Gynandroblastoma	BEFREE	29660837		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	30846478		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	12119278, 22962422, 23246288		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	ORPHANET_DG	23246288		★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	17481480	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23115635, 26026089, 26450902, 29247557, 29297949, 29506489, 31252679, 31597661, 31785230		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22577058, 23115635, 23408298, 24245510, 26666511, 26895469, 30642292, 32628350, 32669614, 33919657, 34247193, 34344926, 39684472, 39695576	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	32590727	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32460327, 34612779	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17885560, 26034202, 27249321, 28112209, 29358197, 30257319, 30974752		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17885560, 21098579, 32460327, 34275376, 35128826	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21193562	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemangioblastic Meningioma	Hemangioblastic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	23298485, 24704994, 26308070, 28337869, 30562741, 30584986, 31074018, 31838054		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	39286286	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangiopericytic Meningioma	Hemangiopericytic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	22648906, 25726712		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	22648906	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	31726910, 36906972	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16645590, 23380710, 28590011, 29928335, 30986068		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	16645590, 23380710	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	24642468		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	18317450, 27741509, 27804235		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	26884885	Associate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	25915946	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	22500628, 25722288, 35441233	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	23449172, 24853778, 25451314, 28427592, 28969385		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23761422	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	37795100	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26919045, 30111572, 30209179, 36052278	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	17131467, 25645159	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27252525, 35712812, 37223041	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32050950	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19584164, 26516161		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	30809316, 31541079, 33780361, 34996511, 35507738	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	21324921		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	34073781	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20101210, 21574647, 22460814, 23620408, 23895914, 24811059, 26577839, 29453318, 29739933, 30394935, 32088208, 32393308, 36916425, 37736741, 40437613	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	37181035	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30744607		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	28011673		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	19731079		★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	12011061	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Motor Neuropathy	Hereditary sensory and motor neuropathy	Pubtator	17440983	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26991540, 30062828		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	30062828, 36214716	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	25377560		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15772702, 17375124, 27767172, 30352904, 30610809, 31128034		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16412023, 22343918, 27870927, 30610809, 31128034, 36831273	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17375124		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	12062094, 28973411	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	15845076		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20237277, 28973411, 31797328		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	27922982		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	38409834	Associate	★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	27922982		★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	23626817	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	31691359		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	15010337		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	15964918, 18725974, 25385439, 28489509, 32312891, 33377972, 33967958	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18599614, 31828164	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23636253, 24061149, 29260360, 29459024, 29677194, 30444716, 31178235, 31286327, 31396301		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	34299331	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29660344		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11162573, 19581418, 21241768, 21295959, 24957076, 28756250, 29183784, 30110341, 30381838, 30459598		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	33967958	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	37929023	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29078297, 29172017, 31178235		★☆☆☆☆ Found in Text Mining only
Hyperlysinemias	Hyperlipidemia	Pubtator	34068442	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	27550858		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	26196743	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	33215223	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	14767488, 33114687, 35805203, 37302654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	14611643, 37154169	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15136501, 27297622, 29212405, 30176313, 30229842		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15136501		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	28483784, 31736784		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28582432, 28911943		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28582432		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21061022, 22879939, 28951244, 33416124, 34650188	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	29317200, 36123941	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19700418		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	29316063		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	22729222	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29883676		★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	29260360		★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12482504, 15220111, 15987743, 17158959, 18976673, 19036873, 19919574, 20920536, 21408136, 23145312, 23558942, 25860915, 26078356, 27581620, 30755508, 31796646, 31992313, 34200497, 34522167, 35283481, 40244269	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12495471, 12764143, 16014625, 18351386, 19328625, 19473970, 21048308, 21499308, 22245152, 23545606, 23696831, 25166211, 25562170, 25596742, 25849550, 25961449, 25961455, 26193287, 26572277, 26842559, 26974319, 27298257, 27563096, 28410212, 28415624, 28578351, 28806945, 29426376, 29524521, 29866927, 30237409, 30258464, 31088860, 31931758, 32197467, 33215223, 33537802, 33762574, 34105393, 34299186, 34332565, 34637697, 34916780, 35055064, 35413842, 35671789, 36694434, 36829192, 38008826, 38308220	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18566221, 24905002, 29843131	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31082354		★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	37960775	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	18413758, 20856200, 26909593, 28556791, 30962488		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23972212, 27297622, 28824319, 29358461, 29633623, 30387816, 30753867, 31176777, 31841211		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20061390, 20109444, 21893017, 23580232, 24728102, 26138239, 27218286, 27769060, 29144435, 29563341, 29568927	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29568927, 30171960, 30928090, 31661644		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23442539		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37029297	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16166293, 26351323, 27645691		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21187413, 21788944, 22525159, 29290948, 29312496, 30787593, 30828070, 31685977, 31710934		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457, 36369952	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21637825, 25569743, 25927528	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28659381, 30385297		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24233241, 24634376		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	15339744, 17131467, 17227768, 18160431, 18364460, 18443205, 20872231, 21061022, 21297971, 22721429, 22970944, 23344726, 25645159, 26386696, 26604643, 27187341, 27857189, 28050343, 29207074, 29298529, 29709004, 30992506, 31389668, 31679138, 32651353, 32969494, 34376475, 34646087, 34718921, 34946711, 35216514, 35449053, 35987697, 36209087, 36325267, 36517007, 37409718, 38018587, 38102588	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22403297, 29955086	Inhibit	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	25919186		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24563264		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32014856	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29137981		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24376640, 24603539, 31746390, 32271398, 32271399, 32901877, 34382895, 34554926, 34974804, 36746221, 37603510	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31546235		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	21590431, 35960059	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	21590431	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21590431		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	22384056, 23935891		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	24260544	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	28338184	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27976455		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	22088438, 23376645, 26877611, 28733220, 29545603, 30084835, 30266493, 31195063		★☆☆☆☆ Found in Text Mining only
Intraorbital Meningioma	Intraorbital Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Intraventricular Meningioma	Intraventricular Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29551677, 29552125		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30693516		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	25927528	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	17186162		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	29228674		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31589938		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	24422998, 30170375		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25247416, 28902914, 29860458	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29860458		★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	21078999	Associate	★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28685447		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	24112608, 25961698, 25987255		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11918736, 34326314	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17272402, 31810732		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	35908957	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30880031, 30970510		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	19850877		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19850877, 22685542, 24175769, 24797175, 25016284, 25149531, 25757764, 26633711, 27226530, 27460078, 28713889, 29424922, 30003754, 30840265, 31002126, 31717694, 32668608, 36849137, 36966254, 39780215	Associate	★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	BEFREE	27522498		★☆☆☆☆ Found in Text Mining only
Kosaki overgrowth syndrome	Kosaki Overgrowth Syndrome	BEFREE	30941910		★☆☆☆☆ Found in Text Mining only
Larsen Syndrome	Larsen syndrome	Pubtator	35832491	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25008564, 25120770, 32096156, 32633370, 33415169	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26883008, 27533461, 28078305		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	24980293	Associate	★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	22350026, 28002802, 29258902		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17468044, 17885560, 30718600		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18439583, 19464003, 19772960, 24476133, 27748285, 30292626, 31159158, 32892998, 34224241, 36771423	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17496901, 22648906, 28002802		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	21326806, 23532091, 29258902, 33377972	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	HPO_DG			★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	20308328, 28582432, 28911943		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	25708222, 25917897	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12592338, 19002588		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15494423, 15782127, 15860672, 17673311, 17928528, 18414037, 19375649, 19406989, 19641183, 19661292, 19773546, 19880494, 19883517, 20007139, 21828124, 21887305, 22142798, 22207684, 22491738, 23001822, 23812937, 23832765, 24244612, 24412064, 24454800, 24850755, 25273171, 25360637, 26191229, 26472107, 27035679, 27531894, 27821800, 28596424, 28704451, 30934922, 31053167, 31173300, 31922221, 32862609, 34711640, 35412895, 35650206, 36528059, 36674872, 37554265, 37630388, 7756172, 7849298	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15860672, 16585200, 17169805, 17611497, 17921701, 18053070, 18414037, 18504432, 18665177, 20440266, 21289308, 22094587, 22491738, 23705826, 24154679, 24244612, 25164873, 26013878, 26611474, 27018341, 27756877, 27757735, 29312576, 29927999, 30185437, 30278103, 30841886, 31291942		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33649851	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15665116, 26496029, 27035679, 33439746	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11745387, 15289327, 15840695, 16304046, 17179228, 17259349, 17878402, 18160664, 19010914, 20007139, 20810927, 21660042, 22407228, 22828407, 23320091, 23380710, 23474756, 23705826, 23812937, 23919981, 23940660, 23955073, 24412064, 24850755, 24935396, 25759982, 26967055, 27248172, 27531894, 27656831, 27903985, 28098170, 28361855, 29080039, 29442453, 30536332, 30651113, 30799283, 31053167, 31744268, 31954876, 32393312, 33299888, 33576342, 34656078, 34792179, 35240791, 35370472, 35412895, 35490271, 35794161, 35895896, 36413544, 36509141, 36520954, 36528059, 37038247, 37313984, 37855060, 38179723, 39273530, 39343915, 39867885, 39898241	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12027902, 26397153, 27840989, 30536958	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	19880494		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28011673		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16585200, 17128418, 17169805, 18053070, 18160664, 18317450, 19457552, 21233840, 21660042, 22613795, 22751135, 22820502, 23127761, 23243017, 23263202, 23380710, 23499911, 23867056, 24282218, 24850755, 24935396, 24975213, 25322685, 25801978, 27071307, 27531894, 27764807, 28082369, 28418085, 28462918, 28537457, 28629311, 29276026, 29296810, 29559471, 29753379, 29938007, 29997504, 30472492, 30544932, 31056348		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17169805, 17581609		★☆☆☆☆ Found in Text Mining only
Leukemia, Natural Killer Cell Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	19880494		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12009899, 19147787, 22491738, 26436088, 27936393, 29688264		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	30541897, 31027732		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	32887355	Associate	★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	15835270		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	22350026, 28002802, 29258902		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21795477, 23806066, 27200496, 31252679		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	35290761	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	24695632, 29061812		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	24695632, 26518767, 33114687	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	20522586, 22020193, 35672466	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	19368956		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	24321521		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11261840, 12361705, 14767876, 16184552, 17717605, 18392055, 19054267, 19591801, 20473866, 21147110, 21324921, 21391741, 21835141, 22171994, 22262416, 22428038, 22617155, 22618716, 22957763, 23023935, 23167739, 23376645, 23474367, 23580179, 23684551, 23709421, 23838576, 23870199, 23874836, 24036604, 24223153, 24247267, 24297510, 24402647, 24556693, 24574717, 24608572, 24675684, 24931142, 24960055, 25280563, 25420499, 25424347, 25537506, 25617127, 25778319, 26004137, 26026051, 26156803, 26160280, 26249360, 26287185, 26493996, 26857837, 27058618, 27191994, 27519414, 27611696, 27623945, 27699664, 27779207, 27779641, 27821810, 27901475, 27919945, 28085697, 28098858, 28231734, 28240051, 28256185, 28336971, 28346420, 28442344, 28445151, 28456666, 28489585, 28498444, 28506857, 28518144, 28566435, 28646927, 28649002, 28680363, 28867187, 28877210, 28881732, 28915706, 28922551, 28977851, 28978011, 29048612, 29117515, 29133128, 29179215, 29298655, 29299170, 29332411, 29344189, 29378174, 29445189, 29454285, 29506532, 29510736, 29541403, 29572888, 29636997, 29689643, 29725418, 29734164, 29739391, 29867489, 29914442, 29928419, 29991125, 29992971, 29997441, 30017965, 30089483, 30098425, 30103712, 30111352, 30111572, 30127980, 30182439, 30195041, 30231922, 30235011, 30279729, 30311444, 30382631, 30418964, 30473218, 30483804, 30509085, 30535530, 30582951, 30588188, 30655811, 30784932, 30805927, 30854092, 30944640, 31054856, 31062368, 31085375, 31088485, 31113871, 31118799, 31147216, 31151404, 31205541, 31239700, 31293639, 31298047, 31335281, 31354289, 31368655, 31383647, 31388332, 31396320, 31417635, 31442665, 31476254, 31481232, 31497229, 31533816, 31541003, 31576658, 31632530, 31657972, 31663122, 31666112, 31712058, 31802891, 31814899, 31849449		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19054267, 27748901		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28691020, 30326962, 36246566	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17599743	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25537506	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25080058		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35236826	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30171166		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12361705, 14767876, 21324921, 22617155, 23376645, 24556693, 25537506, 25762642, 26857837, 27614046, 27919945, 28481866, 31476254		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	19132987		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	25537506	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35236826, 37542825	Associate	★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	26617788		★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	28499984		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26468985, 26572277, 29328793, 31527305, 32327430, 32457348, 33140889, 34409758	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	26033700		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	12511591, 21911043, 22619562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12511591, 12529380, 14762343, 15642728, 16648865, 17032498, 17150102, 18483303, 18566221, 18676680, 19090006, 19176399, 19337377, 19351834, 19568240, 19937138, 20332232, 20346214, 20447721, 20885957, 21258249, 21525012, 21618507, 22057915, 22313637, 22363436, 22408435, 22753015, 22885155, 23091605, 23226337, 23319332, 23349696, 23443799, 23693014, 23724143, 23761130, 23951036, 24280348, 24498263, 24659658, 24757411, 24913497, 25109354, 25149157, 25266803, 25337231, 25687876, 25855050, 25861627, 25937299, 26046675, 26065336, 26098947, 26314828, 26463718, 26464663, 26486080, 26573869, 26645682, 26683690, 26689593, 26884842, 26942697, 27015122, 27289442, 27422710, 27484721, 27602961, 27833080, 28139737, 28173828, 28209923, 28232663, 28272723, 28350337, 28393246, 28465488, 28662101, 28716898, 29024500, 29130967, 29171984, 29568927, 29620222, 30058690, 30461193, 30485130, 30779077, 30779080, 31006666, 31013639, 31115514, 31128006, 31136988, 31485626, 31665911, 31817720, 32005795, 32016970, 32069989, 32162827, 32432744, 32838785, 33029497, 33136091, 33158043, 33297998, 33360044, 33455947, 33506873, 33530617, 33865336, 33880579, 33921340, 34007784, 34107168, 34194828, 34234236, 34308964, 34537206, 34605863, 34773335, 35015757, 35246017, 35302851, 35321703, 35354796, 35542175, 35643725, 35887201, 36003920, 36035842, 36142605, 36203195, 36209201, 36500361, 36615523, 36806050, 36927233, 37189139, 37400960, 39260306, 40076971, 40135405	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	15802268, 16820947, 17616691, 18256540, 18409144, 18644989, 19073147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	18559520, 24374738, 26375550, 26574479, 26654940, 29470540, 31421084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30760089		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23125486, 29762839	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23735868, 23896866, 25989537, 29884225, 31536674, 32576231, 35543435, 36482627, 37585411, 39563449	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30760089		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23125486, 29762839, 30572770, 30760089		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	23896866, 25339666, 37099456	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27590500, 29568865		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30760089		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	25096023		★☆☆☆☆ Found in Text Mining only
Lymphangioma	Lymphangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12115344, 16254112, 17278192, 20808831, 24133589, 25702787, 25855050, 26317520, 27096956, 27188433, 29743718, 32281236, 32750756, 33911067, 35616137, 36982542, 37184125, 38211648	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31436252, 32023262	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	25424831, 30947262, 34170046, 35806420	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	31207081, 31560953		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16263580, 17521720		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21502955, 21859846, 21878679, 22751135, 23127761, 23580656, 23840064, 25625359, 25907832, 26490423, 26503641, 29729186, 30885941		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21987722, 23603894, 25590803, 26585955, 27390358, 31123343, 34382383, 34948236, 35184749, 39735560	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710, 25096023, 33419778	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	34382383	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	25096023		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23603894, 26478515, 27701018, 27840970		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	26478515, 27840970		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16645590, 30194255		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	36254040	Associate	★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	24705253, 24853778, 24888723, 25722288, 28086757, 28969385, 29296277, 29883676, 31056854, 31290289, 31441589, 31639285		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23441106, 34341398, 34823219	Associate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	19470786		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31480771		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	26523971		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28969385, 29679388	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	22648906		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15735908, 16402276, 21720709, 25737557, 28672936, 29069732, 31678282		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23115635, 26026089, 26450902, 29247557, 29297949, 31252679, 31597661, 31785230		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18339899		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22116552		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25501304, 31809978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	24141773		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10441522, 11429232, 12032855, 12244302, 12244303, 12569575, 12761490, 14681726, 16061647, 16144943, 16288304, 16537497, 16951146, 17308086, 17612563, 17804473, 17908967, 18392055, 18676830, 18838536, 18937284, 19074894, 19418217, 20174572, 20471940, 20591134, 20651350, 20664923, 21084382, 21203579, 21209903, 21321378, 21406404, 21406469, 21425139, 21519185, 21574647, 21708937, 21730367, 22021428, 22076481, 22094188, 22177840, 22258408, 22488590, 22494103, 22552300, 22809628, 22875023, 22922893, 22938585, 23085752, 23092874, 23200933, 23237847, 23499909, 23543364, 23643661, 23648148, 23675882, 23711387, 23814023, 23888070, 23900300, 24269953, 24376685, 24403860, 24463007, 24470511, 24481326, 24553191, 24628780, 24706460, 24957076, 25023728, 25071141, 25074979, 25108739, 25199759, 25283550, 25361981, 25422220, 25491778, 25702787, 25735723, 25816324, 25859923, 25869208, 25920913, 25928145, 25976617, 26095475, 26116361, 26165839, 26170662, 26191181, 26194618, 26208487, 26267533, 26316122, 26351323, 26452060, 26515594, 26540293, 26595803, 26631969, 26645663, 26666820, 26672755, 26676464, 26698305, 26758558, 26771843, 26845172, 26869349, 26895380, 26898459, 26945854, 26995633, 27004402, 27022065, 27048245, 27059323, 27113763, 27197157, 27248326, 27292631, 27297869, 27341075, 27447121, 27447863, 27515171, 27563827, 27574028, 27608432, 27738081, 27771839, 27835884, 27853906, 27864123, 28117370, 28123607, 28183251, 28216025, 28218907, 28287129, 28301567, 28381172, 28387904, 28388580, 28418910, 28423521, 28423632, 28427202, 28443643, 28446508, 28459209, 28476032, 28478612, 28487443, 28503860, 28513879, 28522609, 28530703, 28599470, 28627683, 28731146, 28779263, 28810530, 28853539, 28854595, 28874413, 28915591, 28916526, 28964785, 28969041, 29025596, 29055790, 29086897, 29088759, 29100327, 29103666, 29190947, 29202330, 29212252, 29223745, 29262587, 29312549, 29476223, 29482551, 29506489, 29540052, 29556333, 29567542, 29625858, 29707142, 29736694, 29749454, 29808317, 29808803, 29844859, 29925528, 29942081, 30008831, 30038508, 30038706, 30065942, 30087941, 30103105, 30104711, 30106443, 30122991, 30128822, 30135474, 30148117, 30154572, 30171053, 30175868, 30198810, 30244175, 30266800, 30300626, 30320894, 30381079, 30385615, 30406874, 30443181, 30445978, 30454896, 30464609, 30518851, 30552871, 30578411, 30671946, 30720225, 30767161, 30774365, 30808745, 30845749, 30930461, 30993707, 31006103, 31007610, 31011573, 31092275, 31104012, 31182914, 31277699, 31281438, 31308741, 31320990, 31347059, 31359335, 31417306, 31448883, 31626273, 31669347, 31698236, 31746305, 31752925, 31761784, 31769593, 31771180, 31781306, 31827405, 31828441, 31836609, 31844113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG	17611497		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GENOMICS_ENGLAND_DG	23246288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11497285, 15505622, 16273242, 17924977, 18615621, 19491896, 19917135, 20664599, 21093899, 21495229, 21760855, 21952748, 22146979, 22662154, 22911820, 23028188, 23142288, 23174537, 23943160, 24561032, 25068805, 25118299, 25141911, 25534488, 26296520, 26734994, 27259051, 27550940, 27572308, 28098854, 28112582, 28179296, 28202507, 28427207, 28886696, 29182407, 30021163, 30154548, 30298385, 30338797, 30344696, 30402135, 30431102, 30574817, 30779215, 30853360, 30936746, 31192127, 31201812, 31486482, 31588998, 31623857, 31781484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17342332, 17974918, 25912437, 26302489, 27239113, 29530788, 29604392, 29709473, 30636576, 31267531		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26294099, 26947513, 28412732, 28766687, 29416013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31352195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19850877, 28166200, 30281919, 30288056		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29085504, 29299828, 29312563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21147110, 22617155, 23042506, 24625973, 24891117, 25151370, 28769986, 28978011, 28993733, 29400692, 29545895, 29658568, 29720833, 30272296, 30399434, 30720164, 30840267, 31191795, 31312391, 31801250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	12511591, 21911043, 22619562		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17613432, 18256540, 18391978, 18559520, 18566221, 18644989, 18852117, 19337377, 19491896, 19501140, 19802009, 20447721, 20885957, 20959404, 21182834, 21333374, 21688263, 21716144, 21911043, 21996732, 22313637, 22901187, 22941571, 23319332, 23824739, 24469108, 24596211, 24659658, 24789704, 24998847, 25066607, 25448566, 25653196, 25687876, 25697899, 25738369, 25862855, 25880371, 26053093, 26234648, 26573869, 26645682, 26654940, 26676756, 26678031, 26859676, 27050278, 27312177, 27422710, 27431918, 27452907, 27682214, 28218907, 28285180, 28436990, 28454237, 28662101, 28714963, 28716898, 28849122, 28901268, 29151965, 29207183, 29501727, 29568927, 29606701, 29620222, 29712908, 29770473, 29861842, 29916527, 30112033, 30365050, 30390072, 30431081, 30481052, 30510432, 30546837, 30732751, 30864724, 31074646, 31415720, 31467180, 31748336		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21795477, 23806066, 27200496, 31252679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	26499488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15806173, 16584837, 17178867, 17377809, 18392055, 18504432, 18949358, 19638206, 21317880, 22328975, 23408974, 23591839, 23869765, 24036443, 24115647, 24815691, 25176450, 25216292, 25337238, 25677064, 27935869, 28983627, 29401696, 29461589, 30129654, 30245957, 30515820, 30620384, 30672020, 30972187, 31128298, 31210292, 31284467, 31639424, 31752654, 31820522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	16211241, 21266360		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	GENOMICS_ENGLAND_DG	23246288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12865934, 15591514, 17960583, 18783292, 19405118, 19639215, 19901970, 21678117, 23589145, 25017645, 25071014, 25079376, 25238288, 25285629, 26451606, 28000865, 28095588, 28176634, 28179305, 28286270, 28363942, 28400334, 28679769, 29366808, 29461595, 29845225, 30404927, 30464602, 30575903, 30686807, 30770779, 31059194, 31590760, 31686763, 31765735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	29662627, 29902261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10827191, 11461904, 12482965, 15782140, 16114056, 16682621, 17065200, 17083125, 17639041, 17875733, 18336616, 18497063, 18611860, 18627304, 19597465, 20407443, 20620173, 20729295, 21048307, 21125667, 21138868, 22020565, 22045666, 22389719, 22491797, 22509301, 22809628, 22815832, 23027128, 23171135, 23434594, 23567263, 23585456, 23633519, 23701950, 23856248, 24444712, 24737412, 24838891, 24972028, 25322691, 25449774, 25728608, 25749044, 25829425, 25922934, 26033689, 26143945, 26207671, 26261538, 26599430, 26913603, 27044116, 27126362, 27240591, 27329728, 27375016, 27557496, 27606721, 27624889, 27699769, 27705939, 28008155, 28061438, 28082369, 28213961, 28300578, 28350865, 28363000, 28442344, 28494348, 28602980, 28611045, 28802252, 28805822, 28848113, 28875501, 28915623, 28977864, 28981098, 29035829, 29039490, 29156689, 29167276, 29181846, 29298992, 29316844, 29330287, 29330357, 29453322, 29488612, 29523594, 29544736, 29581176, 29755115, 29755129, 30139961, 30140035, 30142541, 30151089, 30340213, 30379590, 30382885, 30446585, 30797819, 30816455, 30851421, 30914801, 30973040, 31037562, 31092266, 31135122, 31145683, 31202735, 31210839, 31266816, 31281490, 31429764, 31766290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15682402, 29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21351258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	21351258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17310852, 17725107, 17984117, 20428959, 22387880, 22907434, 23058013, 24068565, 24088382, 24113181, 24154840, 24165223, 24602839, 24737346, 24752338, 24817940, 24945379, 25015565, 25270272, 25394504, 25400827, 25428377, 25448881, 25914465, 26317520, 26458815, 26701847, 26818920, 26847684, 27010547, 27017226, 27146881, 27156070, 27895401, 28498444, 28550907, 28569779, 28588255, 28608528, 28745795, 29031586, 29039535, 29069776, 29106389, 29237470, 29278851, 29278885, 29332342, 29450946, 29522284, 29540196, 29714127, 29804098, 29917165, 29949784, 30012200, 30015980, 30015981, 30029874, 30157801, 30176223, 30302796, 30305727, 30355273, 30569123, 30680010, 30720166, 30841479, 30881044, 31078520, 31339445, 31352788, 31527621, 31786865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14985374, 19487299, 19638576, 19907326, 20455254, 21196179, 23725177, 25016932, 25029414, 25456951, 26597586, 26695142, 27342662, 27618325, 28137980, 28600475, 29169802, 29207150, 29262541, 29353884, 29420754, 31146260, 31158464, 31181609, 31285773, 31289536, 31693087, 31727500		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30344309, 31291942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19802009, 19875696, 20354165, 22189542, 22285928, 22417847, 22525723, 22895070, 23300058, 23511556, 24122582, 24929024, 25277204, 25349966, 25564356, 26148825, 26312564, 26375441, 28549468, 28889395, 29348843, 29383014, 29463565, 29567231, 29702203, 30060954, 30066842, 30333873, 30515906, 30941989, 31278883, 31298367, 31605287, 31696468		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10769688, 11485901, 11756242, 11882383, 14691457, 15034304, 15331441, 15641016, 15888491, 16288292, 16288295, 16341064, 16418572, 16582622, 16849544, 17018259, 17045203, 17047397, 17143532, 17242701, 17599831, 17611497, 17825284, 17921701, 18167127, 18392055, 18413665, 18665177, 18676830, 18712679, 18794884, 18832597, 18940742, 19074868, 19176382, 19216065, 19347904, 19372560, 19389506, 19420344, 19433066, 19491896, 19501140, 19573809, 19573813, 19574224, 19591801, 19633364, 19693774, 19802009, 19853286, 19875696, 19925030, 19963098, 20022634, 20170541, 20214616, 20358958, 20440266, 20522531, 20844931, 20919962, 21113138, 21339740, 21368888, 21481528, 21563232, 21623170, 21742807, 21878679, 21909130, 22177840, 22189542, 22200790, 22240294, 22271473, 22307544, 22438913, 22453015, 22491797, 22522455, 22543588, 22545132, 22585603, 22685591, 22761812, 22815832, 22880048, 22970268, 22992944, 23042506, 23094058, 23115635, 23231387, 23257898, 23285024, 23292285, 23298485, 23319332, 23354592, 23382236, 23400000, 23408974, 23437041, 23500889, 23527720, 23548265, 23633519, 23639623, 23642907, 23684942, 23705826, 23719831, 23867565, 23912452, 23912456, 24011769, 24039187, 24088382, 24104394, 24133589, 24244612, 24261856, 24333218, 24334295, 24441189, 24479804, 24569712, 24598853, 24599075, 24628780, 24631838, 24632578, 24659658, 24752338, 24769729, 24789658, 24811392, 24838891, 24845030, 24862757, 24913553, 24969680, 24970806, 24978597, 24979463, 25037573, 25060489, 25079376, 25110417, 25126847, 25141911, 25164873, 25167922, 25168244, 25215588, 25301678, 25324001, 25376370, 25418727, 25422220, 25450577, 25569743, 25590803, 25791921, 25797255, 25884336, 25906254, 25920913, 25986931, 26003731, 26084990, 26137473, 26181206, 26224873, 26261538, 26294099, 26302489, 26419468, 26429956, 26455908, 26460954, 26490311, 26577299, 26633882, 26645663, 26654940, 26741489, 26818920, 26880266, 26903300, 26911374, 26912358, 27022065, 27050278, 27058419, 27059323, 27121513, 27126362, 27144339, 27156070, 27178741, 27191687, 27196780, 27197157, 27264533, 27283897, 27292631, 27297869, 27341075, 27498977, 27542768, 27577794, 27626683, 27628214, 27633099, 27663592, 27678456, 27711726, 27860216, 27965317, 27989873, 28002807, 28073681, 28085697, 28104681, 28122142, 28146265, 28152500, 28177128, 28178656, 28205653, 28240679, 28279977, 28315368, 28322787, 28343126, 28350104, 28352193, 28376174, 28379898, 28407774, 28409639, 28420162, 28423632, 28446508, 28467889, 28489509, 28498444, 28501009, 28550454, 28562590, 28590011, 28594589, 28659828, 28677816, 28716898, 28761499, 28802252, 28806782, 28814887, 28820394, 28853539, 28859574, 28889395, 28893801, 28954236, 29017516, 29023587, 29055016, 29074462, 29097657, 29114068, 29130389, 29150397, 29156702, 29190313, 29217540, 29259266, 29295560, 29344189, 29358619, 29358688, 29408858, 29410116, 29453322, 29456661, 29474928, 29477378, 29507656, 29508857, 29552125, 29559472, 29581176, 29642505, 29654866, 29666304, 29693253, 29706964, 29755115, 29756328, 29807230, 29808317, 29844859, 29896285, 29927999, 29928328, 29970138, 29980145, 30009860, 30012111, 30018387, 30031856, 30118842, 30122991, 30138565, 30188700, 30198567, 30245963, 30317599, 30361695, 30372896, 30377337, 30383904, 30417481, 30430148, 30442683, 30446585, 30500680, 30563079, 30574817, 30643008, 30678934, 30688659, 30720164, 30770779, 30798436, 30805885, 30816444, 30849534, 30867802, 30877085, 30881494, 30894683, 30910523, 30951826, 30979616, 31021471, 31054856, 31059051, 31074646, 31078742, 31092275, 31126199, 31128213, 31137681, 31168297, 31185594, 31186741, 31247018, 31252679, 31262910, 31298542, 31322550, 31354352, 31467180, 31477842, 31478386, 31492635, 31500637, 31509395, 31548394, 31560953, 31583906, 31594388, 31618458, 31626273, 31686003, 31698236, 31744930, 31752925, 31781306, 31801949, 31812693, 31830561		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	19846776, 30112810		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	25550560, 28945300		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165, 23899375, 25962638, 26183061, 29130111, 29225475, 29236322, 29800735, 29898430, 30480801, 30710498, 30808417, 31056260, 31075090, 31210295, 31333726, 31729992		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11756242, 16202996, 18283336, 19461960, 20332435, 21425139, 22728329, 23881925, 24338765, 25745998, 25873394, 25889965, 26352871, 26471487, 27191497, 27878243, 28082369, 28675857, 28739729, 28972559, 29130099, 29273065, 29344654, 29364475, 29662189, 30013659, 30338799, 30387805, 30518879, 30788662, 31039290, 31168297, 31186741, 31348616, 31502038, 31524255, 31596887, 31772677		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31992313	Stimulate	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	36324122	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12244302, 12244303, 14612949, 15539407, 15806160, 15987444, 16537497, 16951146, 17299206, 17520698, 17612563, 17914096, 17935714, 18087195, 18184439, 18317451, 18519679, 18625725		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17050554, 19573809, 20054642, 20712882, 21209903, 21406469, 21512767, 21617917, 23049696, 23975425, 24147022, 24166508, 24463007, 24742286, 25074979, 25178514, 25961924, 26070602, 28176758, 28301567, 28446242, 28446508, 29453318, 30383904, 31139940		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17148679, 18398749, 19723646, 22107151, 22116552, 28011673, 28529032, 31060403		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	14630827		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	19747364	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	24598853		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17375124		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	22753663		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12060623, 16707597, 19887560, 21861842, 24300787, 25601471, 27012813, 28035748, 28159923, 28650469, 29682173, 30050750, 30244244, 30670636		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17039417, 19887560, 20053726, 22212915, 22313636, 22402744, 22411914, 25052069, 25475127, 30244244, 35315927, 35419951, 35593307, 35866054	Associate	★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	BEFREE	28502725, 31729162		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	11828257		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11828257, 12499277, 14534536, 16273242, 16818626, 17392427, 17492934, 18323781, 18813315, 19843246, 20173664, 21680547, 22417301, 22453013, 22453015, 22525724, 22693259, 22911700, 23112250, 23239741, 23383069, 23444215, 23564767, 23648148, 23792459, 24133630, 24200692, 24265152, 24265155, 24398473, 24425783, 24490764, 24675012, 24735930, 25165098, 25624498, 25627962, 25797573, 26039541, 26356562, 26490311, 26565903, 26640950, 26678033, 26790143, 27573172, 27650545, 27806323, 27966446, 28082369, 28289382, 28352193, 28410220, 28604419, 28699701, 28705772, 28708099, 28853983, 28921907, 28938534, 29059159, 29100459, 29115540, 29377653, 29551771, 29620236, 29670684, 30237495, 30252545, 30396963, 30568501, 30881453, 30922374, 31040175, 31138602, 31247083, 31322190, 31322550, 31413145, 31535400, 31599425		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11828257, 18400376, 18509361, 18974133		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12606824, 15580309, 15987743, 16470169, 16861905, 17070520, 17640227, 18323781, 18813315, 18984162, 19078992, 19088048, 19593429, 20164843, 20216471, 20647317, 21129359, 21454583, 22194965, 22356677, 22805371, 22911700, 23208503, 23444215, 23642048, 24133630, 24178756, 24265152, 24265155, 24346768, 24733393, 25165098, 25168062, 25223735, 25627962, 25749517, 25956405, 26302068, 26552704, 27015094, 27102439, 27251789, 27502397, 27533251, 27631768, 27689717, 27855389, 27883322, 28140520, 28358423, 28410220, 28699701, 28705772, 28760661, 29048609, 29214525, 29215322, 29498217, 29642855, 30042328, 30195330, 30205394, 30385854, 30611716, 30614798, 30643008, 30728070, 30793515, 30819666, 31486499, 31486500, 31724454, 31924735, 31961483, 32236901, 32703153, 32744696, 32968045, 33137997, 33260159, 33402468, 33478111, 33833342, 33982666, 34215961, 34224305, 34241580, 34582363, 35128947, 35439317, 35682659, 36303457, 36434616, 37539493, 37895015, 37931033, 38295313, 39803607	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CLINVAR_DG	24265152		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20959481, 31173492, 35504869, 36043142	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	30127118		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17181554, 23334667, 25247996, 25269047, 25993161, 26826201, 27102344, 27548314, 27550858, 28082415, 28376212, 28610844, 28923059, 29424888, 31857543, 32070062, 33087175, 33296905, 33772057, 35440040	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	Pubtator	23285163	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	BEFREE	23334667, 25247996, 25857641, 25965831, 25998419, 26826201, 27550858, 27885953, 28082415, 28376212, 28482067, 28610844, 28923059, 29852774, 30649489, 31077268, 31177425		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	CTD_human_DG	23334667		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningiomas, Multiple	Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Meningothelial meningioma	Meningothelial Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Meningothelial meningioma	Meningothelial Meningioma	BEFREE	28376212		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	21315744, 23188793, 23240760, 23972212, 24022875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	22094188, 24022875, 25726893, 31477683, 31618892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	22689948, 25726893, 27305091		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22363598		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	11918736	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11923140, 22065079, 24722292, 29606701, 29968778		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	16077404, 16123394, 17311837, 18511708, 19460788, 21294125, 21701776, 22065079, 24722292, 24762959, 31033201, 31670317	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16077404, 18606715, 21124760, 23817184, 28704762, 28960945, 32708306, 37083070	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29202451, 29666854		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35216514	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20872231, 21061022, 23344726	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20872231, 21061022, 23147115, 29675927		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	19047166, 26098773, 26790143		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	16288293, 24525130, 25829425, 31202735, 31381135		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	38636615	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37501076	Associate	★☆☆☆☆ Found in Text Mining only
Microcystic meningioma	Microcystic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microphakia	Microphakia	BEFREE	31691004		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	37029297	Associate	★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	37390241	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28791398		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	33178826	Associate	★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	24590274		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	30061365		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15782127, 16141349, 20338993, 22393246, 23441106, 25980443, 27367669, 28383489, 28426671, 28930531, 32630532, 36457007, 36625318, 37058031	Associate	★☆☆☆☆ Found in Text Mining only
Mixed Tumor, Mullerian	Mixed Tumor, Mullerian	BEFREE	16580307		★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	30131696		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	24816239		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	14745448, 16583435, 26515520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	14745448, 16583435		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	17825267	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	23554211, 23799155, 23806066, 26191149, 28099936, 29037125, 30941988, 32277652, 32695810, 33099948, 33921647, 34268996, 34318593, 35225439, 36072619, 39201464	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	29156644		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30282066		★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	22460814	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	16123037		★☆☆☆☆ Found in Text Mining only
Multiple lipomata	Multiple Lipomata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11675360, 11857082, 12208757, 17016437, 18499442, 20022634, 22223826, 22445357, 24713927, 24816239, 25369735, 25542900, 26833980, 26845432, 27144172, 27830963, 27919956, 28282033, 28351297, 28356941, 28492559, 28796257, 28881756, 29254208, 29322846, 29371952, 29928335, 29933047, 30338809, 30343114, 30664164, 30867372, 31284669, 31498483, 31540771, 31769620		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11675360, 12391322, 12433678, 15319277, 15470037, 16118318, 16234364, 16418332, 16627469, 16728278, 16818641, 17644731, 18499442, 18635812, 19446321, 21149634, 22985491, 23065523, 23185517, 23613505, 25837824, 26848618, 27144172, 27863383, 28099937, 28154173, 28351297, 28796257, 28899456, 30353128, 30664164, 31564190, 31571328, 32173687, 32746845, 32898245, 33448321, 33549034, 35216969, 35328342, 36053135, 36262053, 36322819, 38554386, 40052893	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11902142, 18635812		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24816239	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27559096	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24155968, 27312110, 35049167, 36341423	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27312110, 30692211		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36814107	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Emery-Dreifuss	Emery-Dreifuss Muscular Dystrophy	BEFREE	30781376		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	37498332	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	25811617, 30125933	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	12529294		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30015844, 31756785		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11861273, 23047954, 25472472, 26521017, 30015844, 37986081	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	31756785	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	21725052, 23445613		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	18468786		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16953217, 20200561, 24598853, 24647617, 26460262, 26473951, 27018341, 27677634, 27852702, 28542127, 28560057, 29312576, 29843123, 30796703, 31291942, 31515296		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17638918		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	23445613, 23748344, 30570876		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	11918736	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	23380710	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	23380710		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	24448315		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20132317, 20467748, 34079221	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22251423, 28373901, 28453729, 28551544, 29503094, 29752300, 30017933, 30487059, 30905784		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34275376	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31377586, 31594751		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	35199541, 36546685	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31370111		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	34830320	Associate	★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	20980393		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	29421985		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28915272, 36230978, 36767649	Associate	★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	LHGDN	17151107		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32047813, 35572732, 35747690	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18452707, 19276680, 19756373, 20927779, 22116667, 23681229, 23987636, 24041865, 24157866, 24386352, 24632578, 25126743, 25762617, 26304234, 26499488, 26568302, 26943030, 27010857, 27891591, 28029649, 28240350, 28588706, 29088815, 29305578, 29409973, 29525743, 29531214, 30001734, 30214154, 30444069, 30479336, 30582216, 30655908, 30718276, 30834525, 30882922, 30944308, 31334669, 31403940, 31699119		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19756373, 22116667, 22610073, 23573286, 23755163, 23838801, 23987636, 24386352, 24606633, 24632578, 24845412, 25165983, 25482932, 25607111, 26339346, 26698246, 26880795, 27010857, 27170279, 27876891, 28256603, 28644386, 29582644, 29693120, 29936709, 30001734, 30141114, 30459351, 30950204, 31115007, 31334669, 31403940, 31523184, 31539126, 31599418, 31634779, 31760895, 31984860, 32013999, 32101017, 32281513, 32400857, 32448862, 32641685, 33122398, 33390776, 33760180, 34224316, 34604387, 34783234, 34894048, 35342334, 35463684, 35545406, 35562651, 35682782, 36075565, 36347827, 36354184, 36607163, 36608137, 36963524, 37070291, 37940975, 38123344, 38518731	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21059916	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	23838801, 26499488, 31786875, 32400857, 36644819	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	26931343	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34576119	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10593857, 10700233, 10749120, 10749983, 10827191, 10972292, 11212254, 11325847, 11485901, 11489829, 11497285, 11752813, 11756242, 11803474, 11857082, 11901476, 12009899, 12112531, 12119278, 12479697, 14534536, 14581353, 15010827, 15183529, 15342383, 15536330, 15677629, 15713897, 15735908, 15837735, 15888491, 15968641, 16051596, 16098065, 16140961, 16166293, 16166331, 16184552, 16286246, 16287065, 16332260, 16461335, 16537497, 16574813, 16582622, 16584837, 16775835, 16818172, 16818626, 17002787, 17016437, 17047065, 17050554, 17138652, 17330838, 17405772, 17426444, 17493236, 17575221, 17606624, 17696196, 17804473, 17804734, 17826033, 17908985, 17924977, 18190825, 18199958, 18256540, 18336616, 18339867, 18339878, 18386816, 18538015, 18577687, 18676830, 18684067, 18790743, 18829562, 18852163, 18986507, 19080742, 19122659, 19124015, 19211844, 19212633, 19276184, 19276680, 19372546, 19394761, 19411062, 19418217, 19420344, 19429661, 19435893, 19470786, 19488783, 19491830, 19491896, 19509163, 19555497, 19621391, 19693774, 19731079, 19843246, 19898424, 19925030, 19963098, 20174572, 20399660, 20407443, 20463309, 20479250, 20495538, 20514448, 20541701, 20546605, 20554786, 20569675, 20599538, 20609351, 20679910, 20813970, 20842106, 20856158, 20940396, 21042278, 21046231, 21078999, 21266360, 21297943, 21321202, 21324921, 21354147, 21406469, 21407808, 21430697, 21502955, 21563232, 21680547, 21734801, 21748247, 21793738, 21795477, 21859846, 21860426, 21911485, 21945955, 21974937, 21980390, 22075556, 22080063, 22107151, 22116552, 22213219, 22305966, 22328975, 22387880, 22475322, 22499437, 22543587, 22614013, 22617155, 22622027, 22710723, 22713753, 22773664, 22798428, 22829656, 22894899, 22971992, 22982652, 23001506, 23021083, 23055545, 23058013, 23085756, 23086777, 23166678, 23171135, 23226206, 23251002, 23261230, 23337888, 23338526, 23376645, 23429431, 23444215, 23470565, 23492774, 23510069, 23564767, 23613428, 23633104, 23639623, 23667466, 23699387, 23719831, 23852799, 23867201, 23888070, 23896716, 23899375, 23900300, 23902739, 23934607, 24000138, 24037315, 24077346, 24088382, 24104394, 24146957, 24147456, 24189753, 24247267, 24260500, 24260544, 24297510, 24316979, 24318467, 24321521, 24323026, 24349488, 24352760, 24376685, 24436048, 24467951, 24498881, 24561032, 24598853, 24599934, 24606897, 24619078, 24631532, 24634413, 24642271, 24652480, 24737412, 24742286, 24746202, 24789704, 24803579, 24811392, 24812411, 24828662, 24897931, 24905095, 24921944, 24929024, 24946858, 24978597, 24979463, 24998847, 25023548, 25023728, 25066607, 25071014, 25122428, 25187230, 25205107, 25220666, 25233069, 25337238, 25342139, 25349966, 25370471, 25374184, 25398131, 25424347, 25448566, 25450577, 25456951, 25482044, 25490861, 25501304, 25537506, 25547115, 25596284, 25605020, 25620467, 25623744, 25702787, 25704383, 25745998, 25749388, 25762642, 25788262, 25834829, 25849943, 25850957, 25853295, 25854175, 25855050, 25886003, 25910231, 25961455, 25961827, 25962638, 25972244, 25992689, 25998419, 26027741, 26039708, 26053093, 26077595, 26098773, 26107137, 26137586, 26160280, 26190111, 26209091, 26279473, 26315674, 26334393, 26351323, 26354852, 26384210, 26390965, 26462158, 26468985, 26471487, 26575174, 26589417, 26617742, 26676747, 26701847, 26795349, 26871295, 26895380, 26917264, 26918909, 26965582, 27007150, 27012497, 27012813, 27022065, 27036045, 27059026, 27112325, 27125403, 27126362, 27130667, 27155790, 27178741, 27184479, 27248326, 27270901, 27305487, 27348973, 27370604, 27374081, 27419830, 27507618, 27515171, 27574028, 27577794, 27611696, 27614046, 27663511, 27716613, 27726892, 27863423, 27864123, 27885953, 27891591, 27893711, 27910734, 27960601, 27986626, 28002802, 28003335, 28029649, 28073681, 28077784, 28081222, 28082369, 28125812, 28131206, 28153863, 28160553, 28160570, 28162280, 28184024, 28188683, 28206962, 28209617, 28231742, 28247844, 28279977, 28282033, 28285180, 28287129, 28293832, 28301567, 28347666, 28378642, 28387904, 28418919, 28420162, 28445155, 28456796, 28472036, 28476032, 28476657, 28481866, 28489509, 28494239, 28506751, 28522609, 28582432, 28602980, 28603282, 28608528, 28616662, 28622037, 28648934, 28650469, 28667123, 28679769, 28705772, 28718842, 28729699, 28730764, 28733220, 28860825, 28871105, 28903387, 28993733, 29021381, 29036465, 29038421, 29052531, 29055016, 29059166, 29075041, 29114068, 29115407, 29133261, 29133593, 29143824, 29151914, 29165888, 29167276, 29169802, 29175105, 29197878, 29228673, 29231994, 29242604, 29273065, 29334602, 29335887, 29336198, 29355710, 29356692, 29391600, 29393472, 29413947, 29423104, 29428513, 29441725, 29460925, 29463565, 29480364, 29526493, 29540052, 29552226, 29552308, 29562639, 29565450, 29581786, 29635890, 29669855, 29687840, 29695636, 29695638, 29720957, 29729901, 29735543, 29736694, 29755115, 29765548, 29765551, 29777330, 29790226, 29849718, 29857512, 29904909, 29916761, 29924958, 29928341, 29952716, 29959202, 29961813, 29968778, 29970138, 30015950, 30018387, 30034397, 30038258, 30053901, 30065314, 30082413, 30102771, 30104711, 30109500, 30116327, 30157801, 30165047, 30198810, 30203720, 30231239, 30231922, 30237495, 30288018, 30292626, 30302796, 30328340, 30343258, 30352904, 30372570, 30399434, 30404927, 30420967, 30443181, 30476103, 30483811, 30488557, 30506278, 30526672, 30546426, 30575721, 30624667, 30626590, 30649986, 30655739, 30660646, 30682194, 30717751, 30720124, 30720166, 30784932, 30801702, 30805885, 30828264, 30841886, 30857973, 30873585, 30887517, 30899378, 30930461, 30941989, 30945383, 30975663, 30980038, 30984553, 30986623, 31002157, 31025369, 31026007, 31057087, 31060403, 31078742, 31081090, 31085701, 31158464, 31158953, 31162777, 31177425, 31211856, 31217935, 31227503, 31235758, 31238539, 31252615, 31277699, 31308216, 31322140, 31322702, 31349748, 31435020, 31492635, 31492749, 31496725, 31516586, 31527657, 31537175, 31546071, 31546901, 31548394, 31571016, 31571914, 31591588, 31597912, 31603993, 31626273, 31636720, 31660681, 31663655, 31676235, 31706106, 31712395, 31752925, 31754897, 31785230, 31802899, 31802942, 31805962, 31832711, 31836609, 9799739		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30018387		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28125812, 28188683, 29040381, 30338213, 30649196		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	40191870	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35837376, 37478256	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19440551, 28431241, 29867948		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	17898317, 33491544	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	16571745		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	18593924, 24321521, 28397069, 28692055		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12000752, 15255949, 15485492, 15849504, 15972965, 16133873, 17156427, 17379415, 18278068, 18281552, 18325115, 19278624, 19726747, 20490331, 20564403, 21225506, 21290341, 21590687, 21719054, 22192458, 22276108, 23378341, 23618860, 23710710, 24158598, 24173829, 26295826, 26687764, 26891914, 27224546, 27251789, 28423360, 29352113, 29426376, 30755485, 31863533, 32693640, 35909289, 37301315	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12438236, 15849504, 18026138, 19211844, 20463309, 21225506, 21993994, 22135231, 22394107, 22567126, 23220480, 23378341, 23468863, 24039782, 24108003, 24173829, 25228590, 25622909, 26993602, 26996667, 27453342, 27902463, 28423360, 28717423, 28930619, 29184034, 29321326, 29335887, 30301204, 30376373, 31150649, 31682765		★☆☆☆☆ Found in Text Mining only
Neurocutaneous Syndromes	Neurocutaneous Syndromes	BEFREE	26706010		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15026413, 28383489, 36229517, 40141059	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17289346, 22685291, 24933620, 30611996, 31639492, 31839616		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19815051, 22075556, 22499437, 26087898, 26965582, 26978006, 28042953, 28295876, 28344663, 30588264, 30851333		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	16461335		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	23348505, 32070062	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	19246520, 22259051, 24341609, 25474318	Associate	★☆☆☆☆ Found in Text Mining only
Neuronal heterotopia	Neuronal Heterotopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	23911800		★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20176643, 28987868, 29172017, 30805986, 31796646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	31832114		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12373610, 15136468, 15665299, 18224693, 18303439, 19799425, 20159991, 20447721, 20855443, 20881644, 21574647, 21688263, 21722267, 21777670, 21842521, 21959047, 22037177, 22075159, 22240294, 22299584, 22363436, 22717106, 23009336, 23270470, 23454899, 23719831, 23824739, 23923067, 24055012, 24077347, 24133589, 24146957, 24333218, 24659658, 24946858, 24957682, 24998847, 25037573, 25245053, 25304988, 25323938, 25341405, 25662161, 26019170, 26027660, 26046675, 26053093, 26104294, 26108998, 26149216, 26160838, 26269114, 26555006, 26617940, 26637667, 26723875, 27082424, 27312177, 27409677, 27666600, 27748834, 27880728, 28043144, 28097440, 28167505, 28285180, 28332584, 28342452, 28398603, 28404902, 28418919, 28423589, 28454878, 28488541, 28501009, 28662101, 28670367, 28710768, 28731178, 28765579, 28854421, 28933981, 28940757, 28977927, 29024631, 29072684, 29088849, 29151965, 29156644, 29161765, 29207097, 29362431, 29374157, 29393472, 29470540, 29487530, 29547267, 29569784, 29622086, 29731854, 29864943, 29901173, 29928341, 30087612, 30203720, 30223019, 30288055, 30290307, 30333876, 30450569, 30496626, 30565694, 30660770, 30662561, 30662662, 30690883, 30744692, 30832755, 30844110, 30889481, 30940294, 30941980, 30968155, 31032363, 31119158, 31150457, 31173177, 31178144, 31397118, 31401315, 31422225, 31444970, 31485617, 31485626, 31497240, 31508359, 31560169, 31703757, 31715289, 31750252, 31802909, 31819480, 31819514		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	29685991		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12473591, 24634376		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	18714568		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	18497887, 21041608, 22525159, 22831980, 26882038, 27554198, 27753212, 28416594, 29334044, 29653893		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17559672	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	18573875, 19470786, 24957076, 27307439, 28224045, 28359800, 28477532, 28550108, 29078297, 30263000, 31801409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21097644, 21460183, 23344726, 24521217, 25108739, 26386696, 27314662, 28316325, 29367689, 35288456, 35937803, 37004031, 37286617, 37697228	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	23954404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	27481183	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	19011679	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19435893, 24698107, 25158023, 25886003, 28472036, 29482551, 29507656, 31189691, 31746305		★☆☆☆☆ Found in Text Mining only
Olfactory Groove Meningioma	Olfactory Groove Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Olfactory Groove Meningioma	Olfactory Groove Meningioma	BEFREE	28082415		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	37533228	Associate	★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	22688921, 30184529		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	33345447, 37157945	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	23852799		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	23852799	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19302240, 21324373, 22662110, 22954457, 23460186, 26972586, 27669541, 29255496, 30081074, 30451865, 30505322, 31460867, 31652455, 31886203, 33118610, 33926561, 34754325, 34780784, 36253872, 36430655, 36619785, 36635778, 36915153, 37058031, 37788787, 37820587, 39213112	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32052902	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29115424, 30317635, 30970221		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32096202, 32124937, 33206286, 36372373	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	35609324, 36254861	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	31702033	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28739641, 28946117, 29441015, 29794404		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25815782, 26914116, 29158773, 34142171, 34743649, 34799880, 35069454, 38159253, 39213112, 40080935	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	26914116, 28739641, 30506950, 30693508, 31804494		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	16142341		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17218775, 19670450, 21686164, 23372675, 23740448, 24014087, 24132591, 24175786, 24391455, 24447333, 24595049, 24835790, 25261470, 25371071, 25431257, 25700355, 25973047, 26202364, 26526352, 27155790, 28244849, 28272712, 28791373, 29328452, 29393336, 29461588, 29462818, 29510727, 29734183, 29750154, 29762834, 30014744, 30015899, 30092789, 30280767, 30840262, 30944201, 31114985, 31179788, 31322006, 31340526, 31485669, 31646550, 31746363, 31850493, 32033398, 32236598, 32312946, 32334633, 32696868, 32814762, 32975291, 33146000, 33245175, 33277868, 33282634, 33378012, 33797312, 34495871, 34884541, 34950224, 35069780, 35112982, 35310933, 35435107, 35579448, 36047196, 36071872, 36126191, 36584147, 36717782, 37211864, 37237370, 37951196, 38129870, 40481236	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23202914, 24175786, 26164004, 26662962, 27155790, 27352347, 28260104, 28289332, 28401012, 28475001, 28587351, 28623712, 29151914, 29323740, 29416717, 29434694, 29488603, 29552230, 29568924, 29579156, 29702193, 29762834, 29805503, 29807229, 29807230, 29904919, 30014744, 30099814, 30123092, 30142548, 30506278, 30569116, 30666838, 30683853, 31000382, 31011522, 31114985, 31126199, 31238539, 31421084, 31473323, 31571016, 31595984, 31646550		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40676084	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	31837294		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	17377809, 23408974, 25216292		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	24336158, 25893298, 31319139, 31713081, 31737183		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	15337760, 18450971, 27819360, 37317923, 37883761, 38321265	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30521869, 31412919		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15806173, 17178867, 17377809, 22328975, 23591839, 23869765, 24115647, 24815691, 25176450, 25337238, 25677064, 27935869, 28983627, 29401696, 29461589, 30129654, 30245957, 30515820, 30620384, 30672020, 30972187, 31128298, 31210292, 31284467, 31639424, 31820522		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	16211241, 21266360		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ovarian neoplasm	Ovarian neoplasm	LHGDN	19067848		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ovarian neoplasm	Ovarian neoplasm	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11395387, 12087097, 15028555, 15337760, 16002410, 16983702, 17070899, 17218783, 17322388, 17459055, 18075302, 18201274, 18283299, 18353772, 18392055, 18450971, 18813315, 19386116, 19491896, 19576622, 19638206, 19903849, 20003467, 20032415, 20081105, 20404007, 20487263, 20509930, 20607860, 20661131, 20796276, 21057220, 21266360, 21563232, 21655183, 22110186, 22117079, 22266878, 22272332, 22306204, 22312289, 22328975, 22479527, 22594559, 22841590, 23013730, 23178716, 23236423, 23408974, 23545606, 23554977, 23667667, 23714001, 23869765, 24176845, 24336158, 24376747, 24761768, 24815691, 24870723, 25015419, 25268086, 25337238, 25509983, 25643607, 25894377, 26087719, 26151347, 26159849, 26223322, 26261554, 26530725, 26617770, 26824454, 26867929, 26894601, 26937756, 27035617, 27121110, 27129169, 27426307, 27663592, 27819360, 27863372, 28141785, 28281963, 28338172, 28537902, 28634229, 28664898, 28728166, 28951521, 28983627, 29386467, 29552771, 29952249, 30084434, 30165366, 30245957, 30267477, 30594550, 30925458, 31039761, 31128026, 31173285, 31175269, 31234823, 31277702, 31340883, 31350342, 31402794, 31464709, 31752757, 31865146, 31875458, 31957818, 31983100, 32202508, 32312965, 32373947, 32390009, 32521863, 32585451, 32626953, 32626994, 32650224, 32752095, 33090389, 33203236, 33273524, 33297760, 33317907, 33414447, 33509905, 33723724, 33731124, 33921111, 34026291, 34087975, 34162426, 34181826, 34660776, 34886812, 34935692, 35130130, 35299895, 35309839, 35419627, 35639349, 35645119, 35658829, 35696596, 35739532, 35801406, 35929918, 35953860, 36324187, 36335987, 36484512, 36544104, 36587749, 36625999, 36670423, 36727416, 36727938, 36735765, 36766725, 36849137, 37170915, 37254890, 37317923, 37577760, 37582104, 37972389, 38134066, 38241710, 38565343, 38583177, 40301365	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian papillary adenocarcinoma	Ovarian papillary adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	18949358		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	17143532		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	31408114		★☆☆☆☆ Found in Text Mining only
Palmoplantar Keratosis	Palmoplantar Keratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12865934, 15591514, 17960583, 18783292, 19405118, 19639215, 21678117, 23589145, 25017645, 25071014, 25079376, 25238288, 25285629, 26451606, 28000865, 28095588, 28176634, 28179305, 28286270, 28363942, 28400334, 28679769, 29366808, 29461595, 29845225, 30404927, 30464602, 30575903, 30686807, 31059194, 31590760, 31686763, 31765735		★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	38291468	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	31009406		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17483325, 17895832, 25079376, 25673820, 30272271		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15609321, 16532036, 17960583		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21350002, 21980390		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12495471, 12865934, 14647146, 17342093, 17457047, 18783292, 19050262, 19435822, 20630061, 20663861, 20686216, 20697673, 20726858, 20848249, 21118808, 21448903, 21880146, 21980390, 22322295, 22736919, 23180942, 23437362, 23443316, 23992306, 23992308, 24603988, 24670416, 24809702, 24936056, 25017645, 25019574, 25079376, 25238288, 25238546, 25550789, 25632222, 25632225, 25971209, 26261555, 26310818, 26666511, 26760962, 26823712, 26894380, 27014871, 28363942, 28423617, 28591720, 28957417, 29434218, 29461595, 29845225, 29978609, 30046371, 30273298, 30278585, 30411297, 30551529, 30575903, 30686807, 30700740, 31005960, 31015415, 31059194, 31412018, 31590760, 31841183, 32186702, 32294802, 33164330, 33577028, 33591944, 33764366, 33824274, 34461940, 34511884, 34658294, 35111235, 35260193, 35269749, 35283481, 35327583, 35383226, 35758158, 35813473, 35982909, 36118824, 36149758, 36644576, 36790955, 36811277, 36991449, 37164685, 37542052, 37605223, 38297362, 38520747, 39556934	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24248418, 38521069	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	17310129, 33577028, 36218109	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	31602010		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15994200, 17703498, 18682509, 20860430, 24583924, 25456951, 26133772, 26871295, 28901486, 29169802, 29387247, 29474928, 29757257, 30609134, 31161410, 31496725, 31599424		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	12865943	Inhibit	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	19898424, 29454754		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	19898424, 29454754	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	25120759, 30170375	Associate	★☆☆☆☆ Found in Text Mining only
Parasagittal Meningioma	Parasagittal Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	28352668, 28949121, 30362515		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	28352668	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18395980, 21474915, 21658387, 21741444, 21856379, 24933620, 27353512, 27893588, 28181071, 28488766, 29288045, 29608948, 30184529, 30319352, 30455692, 30925459, 30993592, 31331066, 31351366, 31811872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	18395980, 21177249, 24559646, 30640362, 33443209, 34204164, 34520759, 36237735, 37446291, 38062843, 40141059	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	15026413	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27353512		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	27694961		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	27176043, 34432732	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	21407808, 29902261	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	25157953		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	36566872	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30362568		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32520926, 34200970, 34213019, 37047340, 39904707	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22297255, 25862915		★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian Syndrome	BEFREE	26520804, 31056854		★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian syndrome	Pubtator	26520804	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	37639911	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	27572739, 27661110	Associate	★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular Nodular Heterotopia	BEFREE	27694961		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29296277, 31217543		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	19669229, 29159601	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31322702		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	30383904		★☆☆☆☆ Found in Text Mining only
PIK3CA related overgrowth spectrum	Overgrowth Spectrum	BEFREE	25915946, 28525374, 28867506, 29549527, 31361678, 31490637, 31693582		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21113787, 30499772		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31643121		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	27465551, 28288092, 35247260	Associate	★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	24894018		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	27082424		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	24851866	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	34469896	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29215110, 30375624		★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	33765445	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	17977950		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19631369, 23493574, 26373822, 31452406, 33287836, 34480296, 35032287, 36209087, 37737665, 39253602, 39284759	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25303486, 29660344, 31554782		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	15676208, 16384930, 19815050, 30570876, 34059095	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19815050, 30570876, 30571852		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	31810732		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	24888723, 28969385		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	Pubtator	28969385	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Pontoneocerebellar hypoplasia	Pontoneocerebellar hypoplasia	BEFREE	23793931		★☆☆☆☆ Found in Text Mining only
Posterior Fossa Meningioma	Fossa Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	19965668, 20440266, 29152059, 29886060		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26974310, 29152059		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22185211, 24244612, 27018341, 31275848, 31560953		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18414037, 19406988, 19458356, 22491738, 23788636, 24952875, 25241901, 25281505, 26341754, 27107742, 27582570, 27593934, 28716817, 30636930		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	30521869		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30457077		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21725052, 23445613, 30570876, 30571852		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15940637		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	23686339		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	24064688, 28427207		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	29726995, 30624667		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	18829572, 34670536	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10827191, 11461904, 12482965, 15782140, 16114056, 16682621, 17065200, 17083125, 17639041, 17875733, 18336616, 18497063, 18611860, 18627304, 19597465, 20407443, 20620173, 20729295, 21048307, 21125667, 21138868, 22020565, 22045666, 22389719, 22491797, 22509301, 22809628, 22815832, 23027128, 23171135, 23434594, 23567263, 23585456, 23633519, 23701950, 23856248, 24444712, 24737412, 24838891, 24972028, 25322691, 25449774, 25728608, 25749044, 25829425, 25922934, 26033689, 26143945, 26207671, 26261538, 26599430, 26913603, 27044116, 27126362, 27240591, 27329728, 27375016, 27557496, 27606721, 27624889, 27699769, 27705939, 28008155, 28061438, 28082369, 28213961, 28300578, 28350865, 28363000, 28442344, 28494348, 28602980, 28611045, 28802252, 28805822, 28848113, 28875501, 28915623, 28977864, 28981098, 29035829, 29039490, 29156689, 29167276, 29181846, 29298992, 29316844, 29330287, 29330357, 29453322, 29488612, 29523594, 29544736, 29581176, 29693151, 29755115, 29755129, 30139961, 30140035, 30142541, 30151089, 30340213, 30377337, 30379590, 30382885, 30446585, 30797819, 30816455, 30851421, 30914801, 30973040, 31037562, 31092266, 31135122, 31145683, 31202735, 31210839, 31266816, 31281490, 31289621, 31429764, 31766290		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	25631101, 30295140, 34100062	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	29456672		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	29603556		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	25360740	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16971483, 18691549, 19276260, 22563073		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10419456, 10753955, 11461904, 12063252, 12482965, 12738789, 14523021, 14645548, 14985354, 15548330, 15720812, 16007172, 16061480, 16168126, 16186112, 16222118, 16465378, 16543232, 16721361, 16820098, 16847055, 17143537, 17178731, 17486135, 17522055, 17855368, 17876045, 18339874, 18350153, 18386291, 18519641, 18611860, 18646053, 18687691, 18776922, 18790744, 18854827, 18942118, 18959755, 19010869, 19055752, 19079343, 19116269, 19143022, 19244047, 19347904, 19424579, 19433066, 19503095, 19544333, 19549916, 19638584, 19811499, 19850036, 20019190, 20023417, 20216540, 20333644, 20368692, 20407443, 20530556, 20537156, 20606040, 20837598, 21031436, 21048307, 21080918, 21430300, 21824498, 22020565, 22280146, 22307626, 22347457, 22383427, 22389719, 22410775, 22509301, 22647853, 22809628, 22815832, 23133535, 23227138, 23233737, 23287991, 23302227, 23315288, 23515290, 23532895, 23598299, 23646189, 23670050, 23755281, 23773523, 23803661, 23841076, 23991415, 24001151, 24018886, 24098737, 24294372, 24352642, 24574517, 24642271, 24972028, 24980815, 25203674, 25216853, 25252916, 25273821, 25275598, 25342300, 25360799, 25454616, 25684730, 25707690, 25797255, 25851605, 26115086, 26207671, 26252009, 26364608, 26553226, 26599430, 27176634, 27240591, 27399727, 27455254, 27588482, 27590631, 27712587, 27803760, 28039457, 28160462, 28280729, 28339027, 28363000, 28386546, 28614631, 28653900, 28718667, 28805822, 28981098, 29048678, 29211704, 29298992, 29316844, 29330357, 29898731, 30009471, 30078221, 30132513, 30153654, 30291252, 30295140, 30317243, 30333255, 30338790, 30382885, 30551391, 30813597, 30915739, 31135122, 31210839, 31345230, 31364108, 31424678, 31599405, 31714902, 31902674, 31936664, 32039440, 32070055, 32098919, 32294598, 32415173, 32459381, 32492656, 32522441, 32904490, 33009488, 33099951, 33152908, 33503805, 33648424, 33996996, 34044640, 34338146, 34431444, 34509929, 34667276, 34698359, 34791506, 34949659, 35007362, 35086953, 35163245, 35253732, 35387563, 35563663, 35670774, 35864178, 35899176, 35908886, 36008945, 36073002, 36384263, 36418859, 36479732, 36580003, 36625246, 36799165, 36822388, 36841806, 37047027, 37142586, 37240163, 37460872, 37477641, 37501932, 37545219, 37823778, 37879429, 37899170, 38048859, 38087324, 39780215, 40011853, 40188042	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10827191, 20407443, 20501799, 20534477, 21113138, 21840483, 23585456, 23633519, 31766290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14520710, 15467757, 15475446, 16114056, 16543232, 16820098, 17148458, 17469127, 17512923, 17551921, 17584963, 17606718, 17616684, 17823925, 17898861, 18512729, 18776922, 18798258, 18924134, 19116269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15682402, 29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	22218591	Associate	★☆☆☆☆ Found in Text Mining only
Proteus Syndrome	Proteus Syndrome	UNIPROT_DG	18954143, 21793738		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus Syndrome	Proteus Syndrome	BEFREE	21793738, 24850616, 25782637, 26657992, 27112325, 28582432, 30346092, 31058421, 31194862		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus Syndrome	Proteus Syndrome	GENOMICS_ENGLAND_DG	21793738, 23246288		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus Syndrome	Proteus Syndrome	ORPHANET_DG	21793738		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus syndrome	Proteus Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus Syndrome	Proteus Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proteus-Like Syndrome (disorder)	Proteus-Like Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	31408114		★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	17495954		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23314787, 29285178, 29432814, 30483877		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34992498, 37935955	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	18497887, 21041608, 21775978, 22209534, 22525159, 22831980, 26882038, 27554198, 27753212, 28416594, 29334044, 29653893		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	19051289, 21775978, 22525159	Associate	★☆☆☆☆ Found in Text Mining only
PTEN Hamartoma Tumor Syndrome	PTEN Hamartoma Tumor Syndrome	BEFREE	22962422, 24366516		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30967746		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21498912, 22688668, 28428963, 28655554	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	30274147	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20381852, 25339614, 30280794, 33116468, 35134750, 37180749, 40332792	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22383663	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	19520917, 31527305, 34080651	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26192087, 26921108, 28263743, 28687632, 29079731, 31049028, 31401393, 31502903		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20622004, 21910869, 25023548, 27632701, 29581786		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19850877, 24645843, 28166200, 30288056		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17468516		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20844931, 23086777, 23824745, 24448243, 24645843, 25623744, 25757764, 27283897, 27412013, 27498834, 27844272, 28114284, 28691643, 29148041, 29228653, 29228703, 30281919, 30594602, 30655739, 31002126, 31832810		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29415885, 31032350		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31086184		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	25172964, 28739729, 29160922, 29212519, 30089593, 31354352		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	21189286		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	38593276	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29499566		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	35259050	Associate	★☆☆☆☆ Found in Text Mining only
Retinal hamartoma	Retinal hamartoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal nonattachment	Retinal nonattachment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	35410372	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15492278, 16740689, 17604597, 19420344, 19860642, 23222563, 24249257, 28445155, 29098028, 29587339, 29864621, 30509085, 31485609, 31541850, 31674056		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17604597, 23109819, 27488116, 29615601, 29790698, 30291212, 30536303, 31483776, 32323827, 32904674, 33204686, 33896816, 34036380, 34470581, 34804455, 36284668	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	21212100, 30012595		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	18641990	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28521298		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	17506723, 20925002, 37726478	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyoma	Rhabdomyoma	Pubtator	26247533	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15342383, 17696196, 18829562, 23918606, 25427715, 25749378, 31331911, 31757836		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	17696196		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	26412593, 26445453	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma 1	Rhabdomyosarcoma	Pubtator	34067464	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	27413008, 34203273	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17599731, 24294360, 25935347, 26135838, 26265114, 28559961, 29710540, 30273785, 30286793, 30503342, 30912120, 30988781, 31009103, 31028998, 31411001, 31849678		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34477124	Associate	★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	31020406		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	32750756	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	LHGDN	18355439		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	16707604, 17496901, 22648906, 22779686, 23431153, 24058690, 25273173, 27793898, 29620166, 30962488		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21208094, 22107784, 26402468, 27219337, 33266502, 33762319, 35527027	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17409416, 22022506, 23681745, 23922674, 24517182, 26571493, 29036465, 40628996	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11994280, 15800227, 22067664, 25234715, 30170375	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	21809991, 23861137	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	18240972, 39519004	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14745448, 15474909, 15522255, 15581715, 15982448, 16026766, 16395129, 16583435, 16612196, 16987250, 17233643, 17300918, 17383860, 17464696, 17825267, 17915974, 18195713, 18395980, 18497887, 18635704, 18838251, 18855532, 19051289, 19747927, 19931325, 20214684, 20371257, 20421846, 20691427, 20951727, 21049487, 21187413, 21741444, 21788944, 22150081, 22209534, 22277669, 22525159, 22771711, 23442539, 23747160, 25801838, 27305091, 27484635, 28140405, 28283227, 28384043, 28416594, 28467426, 31522868		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	CTD_human_DG	14745448, 15982448, 17915974, 21187413		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	LHGDN	15522255, 16026766, 16987250, 17383860		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	Pubtator	17825267, 18395980, 19051289, 20214684, 21788944, 33276438, 33765445, 33986383, 35062349	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	GENOMICS_ENGLAND_DG	23246288		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Scleroderma	Scleroderma	BEFREE	28884475		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	17524560, 29720235	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	31527710, 37844870	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	32014856	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	21078999		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	18669866, 23429431, 27435270, 28507280, 31771279		★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	26345935	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	29160922		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	29551659		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35090526	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18166586, 29634521, 29956071, 30915758, 31830649		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	18574502, 31384176		★☆☆☆☆ Found in Text Mining only
Sertoli-Leydig Cell Tumor	Sertoli-Leydig Cell Tumor	BEFREE	29660837		★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	31464709		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	24062018, 31682844		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30518812	Associate	★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	19747927, 27753212		★☆☆☆☆ Found in Text Mining only
SHORT syndrome	SHORT Syndrome	BEFREE	23810382, 28934384		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	25009009	Associate	★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Sinonasal undifferentiated carcinoma	BEFREE	28493366		★☆☆☆☆ Found in Text Mining only
Sirenomelia	Sirenomelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19404300, 34948236, 39819714	Associate	★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	20557351, 21351258		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	34074347, 34075774, 34105192	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases, Vascular	Skin Diseases, Vascular	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25267489		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11752813, 21351258, 30692625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	21351258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	22805371	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Central	Sleep Apnea	BEFREE	31485183		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12356726, 16170339, 17322284, 19394761, 20615970, 25122428, 29290965, 29490947, 31231131		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	20346214, 20683448, 24722482, 25122428, 25695729, 27125283, 27765907, 28280736, 30832755, 31781628, 32901891, 34038205, 36717865, 36927233, 39232038	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	24321521		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	25976141		★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23467345, 31361024		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	25377560		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32360069, 35275449	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12097266, 17804734, 19046792, 21110697, 22033727, 22228640, 23196793, 24722280, 25550560, 25855050, 25960215, 26030731, 26080840, 26216950, 26315674, 26574479, 27649518, 28945300, 29581829, 29713826, 30568499, 30674868, 30689967, 30978501, 31058807, 31629677, 31759362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	12727836, 15217935, 18829502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21351258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17342332, 22458600, 22522455, 23510069, 25482044, 25544767, 25724186, 25834829, 25843419, 26302489, 26334393, 26828791, 27974696, 28356983, 28404945, 28418888, 28498460, 28548104, 28801734, 28927043, 29103771, 29151963, 29339720, 29379302, 29563607, 29597090, 29695636, 29738771, 30015941, 30050135, 30082413, 30479571, 30523643, 30887517, 31516586, 31523191, 31554627, 31571914, 31599475, 31669361		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16245318, 16254112, 17052259, 17465209, 17785546, 18349842, 18538015, 19318490, 20513033, 20729916, 20819078, 21071608, 22505597, 22739068, 22865653, 23136087, 23484008, 23730900, 23827155, 24018125, 24192080, 24586454, 24599934, 24669014, 25184138, 25193510, 25622907, 25674742, 25834400, 25980437, 26025965, 26895469, 27031247, 27119232, 27328758, 27584795, 28030848, 28078305, 28877725, 28893350, 28963552, 29360662, 29385406, 29516987, 30041677, 30148841, 30414263, 30423811, 30556871, 30563911, 30657561, 30914776, 30925916, 31213575, 31379147, 31393061, 31422218, 31548239, 31680452, 31756179, 31759362, 32064753, 32099325, 32329846, 32424132, 32555190, 32572877, 32769488, 32823607, 32826876, 32899449, 32961679, 33003449, 33073595, 33174027, 33444335, 33811778, 34768921, 34814915, 34839095, 34878161, 35142162, 35222682, 35381781, 35756492, 35768785, 35773668, 35813482, 35978886, 35983249, 36039387, 36113774, 36169922, 36347827, 36734243, 36825596, 36916400, 36929425, 37341071, 37486536, 37491232, 37608128, 37686118, 39177040, 39930439	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19243631	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18256540, 24158231, 27835880		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25543088		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28623128, 30707166, 31747091		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15543611, 17549376, 17912526, 18712679, 21955398, 22020886, 23021083, 23200321, 23670291, 23730900, 23852799, 24421178, 24599075, 25193510, 26876212, 27358485, 27863406, 28030848, 28119490, 28823407, 28881811, 28987947, 29970878, 30770351, 30987615, 31100640, 31348981, 31637423, 31721164, 31756179, 31805962		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	23873848		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21821462, 25127200, 28122142, 29286143, 31602231		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	22685591		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28764936		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17596878, 18316359, 23147115, 25957914, 28189721, 29525610, 29534306, 31604805, 31712058, 31824338		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	18413758, 20856200, 26909593, 28556791, 30962488		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17310852, 17725107, 17984117, 20428959, 22387880, 22907434, 23058013, 24068565, 24088382, 24113181, 24154840, 24165223, 24602839, 24737346, 24752338, 24817940, 24945379, 25015565, 25270272, 25394504, 25400827, 25448881, 25914465, 26317520, 26458815, 26701847, 26818920, 26847684, 27010547, 27017226, 27146881, 27156070, 27895401, 28550907, 28569779, 28588255, 28608528, 28745795, 29031586, 29039535, 29069776, 29106389, 29237470, 29278851, 29332342, 29450946, 29522284, 29540196, 29714127, 29804098, 29917165, 29949784, 30012200, 30015980, 30015981, 30029874, 30157801, 30176223, 30302796, 30305727, 30355273, 30569123, 30680010, 30720166, 30841479, 30881044, 31078520, 31339445, 31352788, 31527621, 31786865		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14562414, 14605879, 14662022, 17659701, 18782353, 18849546, 19143835, 19199544, 19925030, 19938192, 20032392, 20704765, 20848249, 20954287, 21075859, 21439087, 21841827, 21943213, 22245935, 22292935, 22325465, 22408359, 23058013, 23321169, 23326131, 23555892, 23558861, 24108762, 24260584, 24441189, 24676394, 24817940, 24837198, 24853233, 24887009, 25035961, 25109605, 25120745, 25286393, 25293520, 25342459, 25400827, 25432133, 25433499, 25448881, 25590580, 25767376, 25881601, 25884175, 25909166, 25921630, 25945841, 26018507, 26108989, 26109806, 26213461, 26271669, 26317520, 26420965, 26458815, 26487493, 26701847, 26729197, 26818920, 26909550, 26934444, 26960693, 26980572, 27058427, 27146881, 27156070, 27178818, 27323966, 27572296, 27712585, 27895401, 28012218, 28107526, 28109082, 28117748, 28193908, 28260026, 28339011, 28345638, 28423550, 28423564, 28653901, 28671020, 28743112, 28745795, 28857517, 28950928, 29060929, 29099789, 29222406, 29243780, 29278885, 29306955, 29332342, 29335012, 29336198, 29422082, 29436606, 29450946, 29512685, 29540196, 29590128, 29668670, 29687845, 29690901, 29700210, 29704890, 29879757, 29899167, 29901205, 29973668, 30015980, 30024601, 30064133, 30089248, 30119963, 30274346, 30296012, 30320337, 30404039, 30591093, 30700111, 30720062, 30770791, 30799435, 30844702, 31243897, 31322207, 31337746, 31339445, 31352788, 31399040, 31466817, 31713929, 31786865, 31974627, 31977138, 32020871, 32021099, 32096170, 32109290, 32119655, 32169757, 32284070, 32301398, 32460412, 32530571, 32548851, 32570120, 32591494, 32596290, 32633361, 32675391, 32701211, 32710946, 32862190, 32862591, 32964029, 33021020, 33049688, 33079995, 33099959, 33103284, 33262572, 33314339, 33452458, 33479376, 33537819, 33627124, 33760104, 33859277, 34012990, 34091441, 34110086, 34122616, 34126195, 34326374, 34332586, 34375503, 34437815, 34455762, 34490484, 34546849, 34554347, 34584127, 34608273, 34617858, 34719326, 34753517, 34830011, 34982011, 35151243, 35163779, 35186488, 35307915, 35443723, 35488236, 35507914, 35590327, 35672352, 35676532, 35748914, 35757520, 35758651, 35770962, 35865664, 35866593, 35990250, 36000536, 36193075, 36213324, 36241983, 36367777, 36380570, 36438913, 36453704, 36604355, 36639993, 36967718, 37024798, 37025097, 37082997, 37273453, 37386026, 37392652, 37415737, 37484805, 37488673, 37496999, 37511629, 37591783, 37608281, 37747314, 37868053, 37909722, 37970923, 38096029, 38159377, 38200519, 39394072, 39457390, 40076652	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17310852, 17725107, 18824170		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	26701847		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37953442	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35557984	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26539501, 30211660, 31612303		★☆☆☆☆ Found in Text Mining only
Subcutaneous hemorrhage	Subcutaneous hemorrhage	BEFREE	30898653		★☆☆☆☆ Found in Text Mining only
Subcutaneous lipoma	Subcutaneous lipoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	36355435	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18323784		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28884475, 29720235		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	15710591		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	25658812		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25862915, 28107044, 29386059, 31636099		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25451314, 30458396		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	35456471	Associate	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	23862686	Associate	★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29315990		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	23639623, 24277456, 28104681		★☆☆☆☆ Found in Text Mining only
Testicular Hydrocele	Testicular Hydrocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	LHGDN	17065200		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	24277456		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	29374346		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	23243278	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	30570876		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24356513, 31490637, 34752677	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	16987250, 19378324, 19494770, 20859285, 22232738, 22417847, 23849826, 24722292, 28709620, 29966585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymus Hyperplasia	Thymus Hyperplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	30193323		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	31614935	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	12733712, 14985374, 15119004, 19223551, 20564403, 20877637, 21191179, 21822208, 22549934, 25887589, 26617698, 28328831, 28634282, 29214440, 29426928, 29757257, 30272290, 30576338, 30832753, 31599424, 31642198, 31646573, 31696481, 31902939, 32315324, 32750756, 32924982, 32960462, 33107190, 34104084, 34565758, 35543351, 35592867, 35757470, 36982542, 38132395, 38272883, 39333272	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	20001715, 27618325		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14985374, 19487299, 19638576, 19907326, 20455254, 21196179, 21865360, 23725177, 25016932, 25029414, 25456951, 26384552, 26403329, 26463629, 26597586, 26695142, 27179656, 27342662, 27618325, 28137980, 28600475, 29033690, 29169802, 29207150, 29262541, 29353884, 29420754, 31146260, 31158464, 31181609, 31183073, 31285773, 31289536, 31338155, 31693087, 31727500		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	18831514, 22718346, 28459364, 30242671, 30804115, 31235699, 31922212, 33015797, 35491899, 36773307	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	36982542	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22962422		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	16755107	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14985374, 18831514, 19487299, 19638576, 19907326, 20455254, 21196179, 23725177, 24389136, 25016932, 25029414, 25456951, 26695142, 26859575, 27342662, 27618325, 28600475, 28771744, 29165888, 29169802, 29207150, 29262541, 29353884, 29420754, 31158464, 31181609, 31285773, 31289536, 31392080, 31693087, 31727500		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	14985374		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11839571, 14985374, 15743786, 15870708, 17481480, 18831514, 19487299, 20008023, 21289267, 21898122, 22090271, 22359623, 22928011, 22962422, 23725177, 24098937, 26722413, 27082011, 27453421, 27556512, 27966519, 28042956, 29762852, 29901196, 30779728, 30804115, 31005958, 31235699, 34171097, 34635506, 34870753, 34911834, 34956562, 35264562, 35795862, 36834830, 36982542, 36988258, 37919637, 37932340, 37960775, 38275291	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37047426	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	15743786	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	16245318, 19887755, 23103626, 25749387, 32236620, 32281236, 33174521	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23107319		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Transitional Meningioma	Transitional Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24167614, 24784001, 25009009, 25955731, 26051240, 26540293, 26857281, 27038254, 27484639, 29924958, 30227836, 30237308, 30665374, 31150511, 31388935, 31527768, 31536726, 31703728, 31804921, 31836816, 32042320, 32271430, 32311203, 32312891, 32438621, 33092442, 33176517, 33311440, 33313947, 33495420, 33911067, 33918859, 33946884, 33990623, 34036307, 34199634, 34685748, 34935899, 34975100, 34997317, 35263216, 35715860, 36077309, 36269860, 36863843, 37093683, 37217473, 37400144, 37474008, 37657065, 37711030, 37713894, 37803350, 37980588, 38202644, 38592437, 39769120, 40296903, 40613296	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24295734, 24335962, 24784001, 25153718, 25959272, 26540293, 26741489, 27374081, 27574028, 28036386, 28387904, 28494797, 28576487, 28800861, 29115608, 29228721, 29417298, 29527004, 29675095, 29924958, 30198810, 30227836, 30363988, 30564555, 30713576, 31050709, 31313842, 31320990, 31354356, 31464004, 31480338, 31520748, 31536726, 31680955, 31703728, 31828441, 31841354		★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	29049012	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	12867426, 19276265, 20526286, 21767323, 27918305	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15455398, 23108404, 27918305, 28013293, 28427592, 28903387, 30684133		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24606538	Inhibit	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	25149531	Associate	★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	21987722		★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	34811450	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28659381, 28854064, 31210320, 31534619, 31798714		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	26700664	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neck Obstruction	Urinary bladder neck obstruction	Pubtator	28138557	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16984382, 18288642, 18825409, 19875696, 20354165, 20857258, 21113138, 21408190, 21836020, 22486221, 22895070, 23300058, 23495258, 23624844, 24069250, 24314030, 24840867, 25266796, 25846736, 26148825, 26700664, 26800397, 26823699, 26837847, 26844702, 26955879, 26988652, 28178653, 28191815, 28229220, 28371605, 28714368, 29463565, 29532898, 29854840, 29975926, 30142792, 30941989, 31180621, 31199921, 31262971, 31529191, 31814034, 31957155, 32239176, 32325639, 32382009, 32427884, 32454461, 33470388, 34220332, 34291863, 34861846, 34889689, 35246010, 35317488, 35664354, 36232303, 36575233, 37039264, 37069622, 37070134, 37108067, 37139621, 37248889, 37461061, 37605239, 37932474, 38070277, 38072891, 38200039, 38273747, 39508245, 40586548, 40594996	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	20651405, 26397152	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19389506, 19843858, 22430209, 23107319		★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	23896716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	29902261	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16740689, 23152800, 23819460, 25135429, 25426553, 25563418, 26156805, 26183061, 26411419, 26482612, 26701206, 26933912, 27220494, 28545028, 28682441, 28841361, 29039440, 29286216, 29291370, 29466255, 29509241, 29516642, 29989647, 30003747, 30024596, 30132534, 30333561, 30536307, 30610802, 30697971, 30791957, 30808417, 31026389, 31075090, 31210295, 31250574, 31333726, 31477280, 31530094, 31682716, 31983729, 32277616, 32377753, 32401379, 32618228, 32862603, 33174608, 33179755, 33236135, 33469269, 34269004, 34551673, 34858519, 34939526, 35296731, 35392845, 35458629, 35609330, 35885925, 36263185, 36305754, 36499465, 36535331, 36606668, 36614304, 36652730, 36906972, 37204043, 38056236, 38223603, 38537385, 38561035, 39190388, 39206910, 39273054, 39372720, 39511266, 39557107, 40238841	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25144715, 34082653	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24002033, 29113583, 29381777, 29790226, 30206313		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	17044934, 32994315	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	LHGDN	18071906		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	21828154, 22733540, 27928645, 28138035, 32347651, 34931134, 36596361	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	22733540, 23443802, 23849826, 28253717, 30211813, 30825222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	25582773, 29512749		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24850616, 36118829	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	24850616		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	21920521, 36930472	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25363469, 25395850, 29307883, 30195866, 34873055, 37039367, 37154169, 38195507	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31810732		★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	34040190	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	33982767	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26364720	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	30057669	Associate	★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	28818232		★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Venous Malformations Multiple Cutaneous and Mucosal	Venous malformation	Pubtator	23633549, 32867785, 38367816	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	21737128	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	32156832, 38215128	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30487059		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	21098579, 37697228	Associate	★☆☆☆☆ Found in Text Mining only
Visceral angiomatosis	Visceral angiomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31797544		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24410795, 31941556, 35777015	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	24388052, 33760200, 36672142, 37537538	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	18334673, 25371371, 28548645	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	27836860, 28548645		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	32320127	Associate	★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	33564861	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31035970, 32004974, 32633351, 34723730, 35485274, 37955537, 38365477	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatous Meningioma	Xanthomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	21771908		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	29953987		★☆☆☆☆ Found in Text Mining only