AKR1B15 (aldo-keto reductase family 1 member B15)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 441282
Gene name Aldo-keto reductase family 1 member B15
Gene symbol AKR1B15
Synonyms (NCBI Gene)
AKR1B10LAKR1B10LAK1R1B7AKR1R1B7
Chromosome 7
Chromosome location 7q33
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT776279 hsa-miR-3907 CLIP-seq
MIRT776280 hsa-miR-4299 CLIP-seq
MIRT776281 hsa-miR-4456 CLIP-seq
MIRT776282 hsa-miR-548q CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23 Show/Hide all (23)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004032 Function Aldose reductase (NADPH) activity IBA
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity IDA 25577493
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity IEA
GO:0004303 Function Estradiol 17-beta-dehydrogenase [NAD(P)+] activity TAS
GO:0005515 Function Protein binding IPI 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616336 37281 ENSG00000227471
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
C9JRZ8
Protein name Aldo-keto reductase family 1 member B15 (EC 1.1.1.-) (EC 1.1.1.300) (EC 1.1.1.54) (Estradiol 17-beta-dehydrogenase AKR1B15) (Farnesol dehydrogenase) (EC 1.1.1.216) (Testosterone 17beta-dehydrogenase) (EC 1.1.1.64)
Protein function [Isoform 1]: Catalyzes the NADPH-dependent reduction of a variety of carbonyl substrates, like aromatic aldehydes, alkenals, ketones and alpha-dicarbonyl compounds (PubMed:21276782, PubMed:26222439). In addition, catalyzes the reduction of andro
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00248 Aldo_ket_red 15 → 294 Aldo/keto reductase family Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at highest levels in steroid-sensitive tissues, such as placenta, testis and adipose tissue. {ECO:0000269|PubMed:25577493}.
Sequence 
MATFVELSTKAKMPIVGLGTWRSLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQ
EKIQEKAVMREDLFIVSKVWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKTGD
DFFPKDDKGNMISGKGTFLDAWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFKLSDEEMATILSFNRNWRAFD
FKEFSHLEDFPFDAEY
Sequence length 316
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Pentose and glucuronate interconversions Estrogen biosynthesis
Fructose and mannose metabolism  
Galactose metabolism  
Glycerolipid metabolism  
Folate biosynthesis  
Metabolic pathways  
Sort by:
AKR1B10 5 shared pathwaysPentose and glucuronate interconversions, Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Folate biosynthesis Related via 5 shared pathways including Pentose and glucuronate interconversions, Fructose and mannose metabolism. AKR1B1 5 shared pathwaysPentose and glucuronate interconversions, Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Folate biosynthesis Related via 5 shared pathways including Pentose and glucuronate interconversions, Fructose and mannose metabolism. SORD 2 shared pathwaysPentose and glucuronate interconversions, Fructose and mannose metabolism Related via 2 shared pathways including Pentose and glucuronate interconversions, Fructose and mannose metabolism. TKFC 2 shared pathwaysFructose and mannose metabolism, Glycerolipid metabolism Related via 2 shared pathways including Fructose and mannose metabolism, Glycerolipid metabolism. GLA 2 shared pathwaysGalactose metabolism, Glycerolipid metabolism Related via 2 shared pathways including Galactose metabolism, Glycerolipid metabolism.
Cardiovascular disease Linked via 2 of 5 related genesAKR1B10, AKR1B1 Endometrial neoplasms Linked via 2 of 5 related genesAKR1B10, AKR1B1 Hypertension Linked via 2 of 5 related genesAKR1B10, AKR1B1 Autism Linked via 1 of 5 related genesAKR1B10 Hepatocellular carcinoma Linked via 1 of 5 related genesAKR1B10