Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84871
Gene name	AGBL carboxypeptidase 4
Gene symbol	AGBL4
Synonyms (NCBI Gene)	CCP6
Chromosome	1
Chromosome location	1p33

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT771678	hsa-miR-1238	CLIP-seq
MIRT771679	hsa-miR-1254	CLIP-seq
MIRT771680	hsa-miR-1290	CLIP-seq
MIRT771681	hsa-miR-1825	CLIP-seq
MIRT771682	hsa-miR-3116	CLIP-seq
MIRT771683	hsa-miR-3120-5p	CLIP-seq
MIRT771684	hsa-miR-3128	CLIP-seq
MIRT771685	hsa-miR-3140-3p	CLIP-seq
MIRT771686	hsa-miR-4254	CLIP-seq
MIRT771687	hsa-miR-4292	CLIP-seq
MIRT771688	hsa-miR-4308	CLIP-seq
MIRT771689	hsa-miR-4475	CLIP-seq
MIRT771690	hsa-miR-450b-5p	CLIP-seq
MIRT771691	hsa-miR-4691-5p	CLIP-seq
MIRT771692	hsa-miR-4765	CLIP-seq
MIRT771693	hsa-miR-502-5p	CLIP-seq
MIRT771694	hsa-miR-507	CLIP-seq
MIRT771695	hsa-miR-511	CLIP-seq
MIRT771696	hsa-miR-520f	CLIP-seq
MIRT771697	hsa-miR-557	CLIP-seq
MIRT771698	hsa-miR-661	CLIP-seq
MIRT771690	hsa-miR-450b-5p	CLIP-seq
MIRT1927740	hsa-miR-4530	CLIP-seq
MIRT771694	hsa-miR-507	CLIP-seq
MIRT771697	hsa-miR-557	CLIP-seq
MIRT1927741	hsa-miR-922	CLIP-seq
MIRT2168574	hsa-miR-1298	CLIP-seq
MIRT2168575	hsa-miR-2355-5p	CLIP-seq
MIRT2168576	hsa-miR-3674	CLIP-seq
MIRT2168577	hsa-miR-412	CLIP-seq
MIRT771688	hsa-miR-4308	CLIP-seq
MIRT1927740	hsa-miR-4530	CLIP-seq
MIRT771691	hsa-miR-4691-5p	CLIP-seq
MIRT2168578	hsa-miR-4719	CLIP-seq
MIRT2168579	hsa-miR-4775	CLIP-seq
MIRT2168580	hsa-miR-485-3p	CLIP-seq
MIRT2168581	hsa-miR-487a	CLIP-seq
MIRT1927741	hsa-miR-922	CLIP-seq
MIRT2443306	hsa-miR-216a	CLIP-seq
MIRT2443307	hsa-miR-216b	CLIP-seq
MIRT2443308	hsa-miR-371-5p	CLIP-seq
MIRT2443309	hsa-miR-495	CLIP-seq
MIRT2443310	hsa-miR-515-5p	CLIP-seq
MIRT2443311	hsa-miR-888	CLIP-seq
MIRT2471190	hsa-miR-452	CLIP-seq
MIRT2471191	hsa-miR-4676-3p	CLIP-seq
MIRT2471190	hsa-miR-452	CLIP-seq
MIRT2471191	hsa-miR-4676-3p	CLIP-seq

40 Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IBA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	23085998
GO:0005794	Component	Golgi apparatus	IEA
GO:0005814	Component	Centriole	IDA	23085998
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015631	Function	Tubulin binding	IBA
GO:0015631	Function	Tubulin binding	IEA
GO:0015631	Function	Tubulin binding	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0030424	Component	Axon	IEA
GO:0035608	Process	Protein deglutamylation	ISS
GO:0035609	Process	C-terminal protein deglutamylation	ISS
GO:0035610	Process	Protein side chain deglutamylation	ISS
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IDA	23085998
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0098930	Process	Axonal transport	IEA
GO:0098957	Process	Anterograde axonal transport of mitochondrion	IEA
GO:0098958	Process	Retrograde axonal transport of mitochondrion	IEA
GO:0120222	Process	Regulation of blastocyst development	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA

MIM	HGNC	e!Ensembl
616476	25892	ENSG00000186094

Q5VU57

Protein name

Cytosolic carboxypeptidase 6 (EC 3.4.17.24) (ATP/GTP-binding protein-like 4) (Protein deglutamylase CCP6)

Protein function

Metallocarboxypeptidase that mediates protein deglutamylation of tubulin and non-tubulin target proteins. Catalyzes the removal of polyglutamate side chains present on the gamma-carboxyl group of glutamate residues within the C-terminal tail of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00246	Peptidase_M14	174 → 439	Zinc carboxypeptidase	Domain
PF18027	Pepdidase_M14_N	46 → 166	Cytosolic carboxypeptidase N-terminal domain	Domain

Sequence

MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQ
VSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKS
TSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDS
LQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVC
QGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVH
PTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLC
QNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTE
EAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPA
SNYPNSKGDKKSSVNHKDPSTPF

Sequence length

503

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (20)
AGBL4-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 30061737, 30061737, 35872910, 39537608, 40050429, 40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	28881265	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	37673066	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	37947095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30626913, 33479212, 34045744, 34586374	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29942085	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	30626913, 31740837, 35396580, 36137488, 39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Age related macular degeneration	Age-related macular degeneration	BEFREE	17293598, 23365078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26993597	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	37370144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASCAT_DG	28881265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35295612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23365078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30626913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	17293598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	30626913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

AGBL4 (AGBL carboxypeptidase 4)

Bookmark This Gene