Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	153
Gene name	Adrenoceptor beta 1
Gene symbol	ADRB1
Synonyms (NCBI Gene)	ADRB1RB1ARBETA1ARFNSS2RHR
Chromosome	10
Chromosome location	10q25.3
Summary	The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801253	G>A,C	Drug-response	Coding sequence variant, missense variant

860

Show/Hide all (860)

miRTarBase ID	miRNA	Experiments	Reference
MIRT717492	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717491	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717490	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT717489	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT717488	hsa-miR-2113	HITS-CLIP	19536157
MIRT717487	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT482411	hsa-miR-3919	PAR-CLIP	21572407
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	21572407
MIRT482408	hsa-miR-3183	PAR-CLIP	21572407
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	21572407
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	21572407
MIRT482406	hsa-miR-4330	PAR-CLIP	21572407
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT230271	hsa-miR-3909	PAR-CLIP	21572407
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	21572407
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	21572407
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT539393	hsa-miR-1273d	PAR-CLIP	22012620
MIRT482412	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT482411	hsa-miR-3919	PAR-CLIP	22012620
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	22012620
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	22012620
MIRT539392	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT482408	hsa-miR-3183	PAR-CLIP	22012620
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	22012620
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	22012620
MIRT539391	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT482406	hsa-miR-4330	PAR-CLIP	22012620
MIRT539390	hsa-miR-4469	PAR-CLIP	22012620
MIRT539389	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT539388	hsa-miR-4287	PAR-CLIP	22012620
MIRT539387	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT230271	hsa-miR-3909	PAR-CLIP	22012620
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	22012620
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT539386	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT539385	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT482411	hsa-miR-3919	PAR-CLIP	23446348
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23446348
MIRT482408	hsa-miR-3183	PAR-CLIP	23446348
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23446348
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23446348
MIRT482406	hsa-miR-4330	PAR-CLIP	23446348
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23446348
MIRT230271	hsa-miR-3909	PAR-CLIP	23446348
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23446348
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23446348
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23446348
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT482411	hsa-miR-3919	PAR-CLIP	23446348
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23446348
MIRT482408	hsa-miR-3183	PAR-CLIP	23446348
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23446348
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23446348
MIRT482406	hsa-miR-4330	PAR-CLIP	23446348
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23446348
MIRT230271	hsa-miR-3909	PAR-CLIP	23446348
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23446348
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23446348
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23446348
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23592263
MIRT482411	hsa-miR-3919	PAR-CLIP	23592263
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23592263
MIRT482408	hsa-miR-3183	PAR-CLIP	23592263
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23592263
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23592263
MIRT482406	hsa-miR-4330	PAR-CLIP	23592263
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT230271	hsa-miR-3909	PAR-CLIP	23592263
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23592263
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23592263
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23592263
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT449031	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT449030	hsa-miR-548p	PAR-CLIP	22100165
MIRT449029	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT449028	hsa-miR-548aj-5p	PAR-CLIP	22100165
MIRT449027	hsa-miR-548f-5p	PAR-CLIP	22100165
MIRT449026	hsa-miR-548g-5p	PAR-CLIP	22100165
MIRT449025	hsa-miR-548x-5p	PAR-CLIP	22100165
MIRT449024	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT449031	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT449030	hsa-miR-548p	PAR-CLIP	22100165
MIRT449029	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT449028	hsa-miR-548aj-5p	PAR-CLIP	22100165
MIRT449027	hsa-miR-548f-5p	PAR-CLIP	22100165
MIRT449026	hsa-miR-548g-5p	PAR-CLIP	22100165
MIRT449025	hsa-miR-548x-5p	PAR-CLIP	22100165
MIRT449024	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT482408	hsa-miR-3183	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT230271	hsa-miR-3909	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482411	hsa-miR-3919	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482406	hsa-miR-4330	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT482412	hsa-miR-141-5p	PAR-CLIP	27292025
MIRT482412	hsa-miR-141-5p	PAR-CLIP	27292025
MIRT482412	hsa-miR-141-5p	PAR-CLIP	27292025
MIRT482412	hsa-miR-141-5p	PAR-CLIP	27292025
MIRT482412	hsa-miR-141-5p	PAR-CLIP	27292025
MIRT482408	hsa-miR-3183	PAR-CLIP	27292025
MIRT482408	hsa-miR-3183	PAR-CLIP	27292025
MIRT482408	hsa-miR-3183	PAR-CLIP	27292025
MIRT482408	hsa-miR-3183	PAR-CLIP	27292025
MIRT482408	hsa-miR-3183	PAR-CLIP	27292025
MIRT230271	hsa-miR-3909	PAR-CLIP	27292025
MIRT230271	hsa-miR-3909	PAR-CLIP	27292025
MIRT230271	hsa-miR-3909	PAR-CLIP	27292025
MIRT230271	hsa-miR-3909	PAR-CLIP	27292025
MIRT230271	hsa-miR-3909	PAR-CLIP	27292025
MIRT482411	hsa-miR-3919	PAR-CLIP	27292025
MIRT482411	hsa-miR-3919	PAR-CLIP	27292025
MIRT482411	hsa-miR-3919	PAR-CLIP	27292025
MIRT482411	hsa-miR-3919	PAR-CLIP	27292025
MIRT482411	hsa-miR-3919	PAR-CLIP	27292025
MIRT482406	hsa-miR-4330	PAR-CLIP	27292025
MIRT482406	hsa-miR-4330	PAR-CLIP	27292025
MIRT482406	hsa-miR-4330	PAR-CLIP	27292025
MIRT482406	hsa-miR-4330	PAR-CLIP	27292025
MIRT482406	hsa-miR-4330	PAR-CLIP	27292025
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	27292025
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	27292025
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	27292025
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	27292025
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	27292025
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	27292025
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	27292025
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	27292025
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	27292025
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	27292025
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	27292025
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	27292025
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	27292025
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	27292025
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	27292025
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	27292025
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	27292025
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	27292025
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	27292025
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	27292025
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	27292025
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	27292025
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	27292025
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	27292025
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	27292025
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	27292025
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	27292025
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	27292025
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	27292025
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	27292025
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	27292025
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	27292025
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	27292025
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	27292025
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	27292025
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT717492	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717491	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717490	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT717489	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT717488	hsa-miR-2113	HITS-CLIP	19536157
MIRT717487	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT482411	hsa-miR-3919	PAR-CLIP	20371350
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	20371350
MIRT482408	hsa-miR-3183	PAR-CLIP	20371350
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	20371350
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	20371350
MIRT482406	hsa-miR-4330	PAR-CLIP	20371350
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT230271	hsa-miR-3909	PAR-CLIP	20371350
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482412	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT482411	hsa-miR-3919	PAR-CLIP	21572407
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	21572407
MIRT482408	hsa-miR-3183	PAR-CLIP	21572407
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	21572407
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	21572407
MIRT482406	hsa-miR-4330	PAR-CLIP	21572407
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT230271	hsa-miR-3909	PAR-CLIP	21572407
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	21572407
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	21572407
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT539393	hsa-miR-1273d	PAR-CLIP	22012620
MIRT482412	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT482411	hsa-miR-3919	PAR-CLIP	22012620
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	22012620
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	22012620
MIRT539392	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT482408	hsa-miR-3183	PAR-CLIP	22012620
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	22012620
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	22012620
MIRT539391	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT482406	hsa-miR-4330	PAR-CLIP	22012620
MIRT539390	hsa-miR-4469	PAR-CLIP	22012620
MIRT539389	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT539388	hsa-miR-4287	PAR-CLIP	22012620
MIRT539387	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT230271	hsa-miR-3909	PAR-CLIP	22012620
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	22012620
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT539386	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT539385	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT482411	hsa-miR-3919	PAR-CLIP	23446348
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23446348
MIRT482408	hsa-miR-3183	PAR-CLIP	23446348
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23446348
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23446348
MIRT482406	hsa-miR-4330	PAR-CLIP	23446348
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23446348
MIRT230271	hsa-miR-3909	PAR-CLIP	23446348
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23446348
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23446348
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23446348
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT482411	hsa-miR-3919	PAR-CLIP	23446348
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23446348
MIRT482408	hsa-miR-3183	PAR-CLIP	23446348
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23446348
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23446348
MIRT482406	hsa-miR-4330	PAR-CLIP	23446348
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23446348
MIRT230271	hsa-miR-3909	PAR-CLIP	23446348
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23446348
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23446348
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23446348
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482412	hsa-miR-141-5p	PAR-CLIP	23592263
MIRT482411	hsa-miR-3919	PAR-CLIP	23592263
MIRT482410	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT482409	hsa-miR-6777-3p	PAR-CLIP	23592263
MIRT482408	hsa-miR-3183	PAR-CLIP	23592263
MIRT482407	hsa-miR-4723-3p	PAR-CLIP	23592263
MIRT482405	hsa-miR-6769b-3p	PAR-CLIP	23592263
MIRT482406	hsa-miR-4330	PAR-CLIP	23592263
MIRT482404	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT230271	hsa-miR-3909	PAR-CLIP	23592263
MIRT230273	hsa-miR-6852-3p	PAR-CLIP	23592263
MIRT482403	hsa-miR-6509-3p	PAR-CLIP	23592263
MIRT482402	hsa-miR-4436b-5p	PAR-CLIP	23592263
MIRT230274	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT449031	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT449030	hsa-miR-548p	PAR-CLIP	22100165
MIRT449029	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT449028	hsa-miR-548aj-5p	PAR-CLIP	22100165
MIRT449027	hsa-miR-548f-5p	PAR-CLIP	22100165
MIRT449026	hsa-miR-548g-5p	PAR-CLIP	22100165
MIRT449025	hsa-miR-548x-5p	PAR-CLIP	22100165
MIRT449024	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT449031	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT449030	hsa-miR-548p	PAR-CLIP	22100165
MIRT449029	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT449028	hsa-miR-548aj-5p	PAR-CLIP	22100165
MIRT449027	hsa-miR-548f-5p	PAR-CLIP	22100165
MIRT449026	hsa-miR-548g-5p	PAR-CLIP	22100165
MIRT449025	hsa-miR-548x-5p	PAR-CLIP	22100165
MIRT449024	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT769969	hsa-miR-101	CLIP-seq
MIRT769970	hsa-miR-1246	CLIP-seq
MIRT769971	hsa-miR-1299	CLIP-seq
MIRT769972	hsa-miR-137	CLIP-seq
MIRT769973	hsa-miR-142-3p	CLIP-seq
MIRT769974	hsa-miR-144	CLIP-seq
MIRT769975	hsa-miR-19a	CLIP-seq
MIRT769976	hsa-miR-19b	CLIP-seq
MIRT769977	hsa-miR-218	CLIP-seq
MIRT769978	hsa-miR-219-5p	CLIP-seq
MIRT769979	hsa-miR-2467-5p	CLIP-seq
MIRT769980	hsa-miR-25	CLIP-seq
MIRT769981	hsa-miR-3152-5p	CLIP-seq
MIRT769982	hsa-miR-3194-3p	CLIP-seq
MIRT769983	hsa-miR-32	CLIP-seq
MIRT769984	hsa-miR-326	CLIP-seq
MIRT769985	hsa-miR-330-5p	CLIP-seq
MIRT769986	hsa-miR-3545-3p	CLIP-seq
MIRT769987	hsa-miR-3615	CLIP-seq
MIRT769988	hsa-miR-3619-3p	CLIP-seq
MIRT769989	hsa-miR-363	CLIP-seq
MIRT769990	hsa-miR-3667-3p	CLIP-seq
MIRT769991	hsa-miR-367	CLIP-seq
MIRT769992	hsa-miR-3977	CLIP-seq
MIRT769993	hsa-miR-3978	CLIP-seq
MIRT769994	hsa-miR-4265	CLIP-seq
MIRT769995	hsa-miR-4279	CLIP-seq
MIRT769996	hsa-miR-4296	CLIP-seq
MIRT769997	hsa-miR-4322	CLIP-seq
MIRT769998	hsa-miR-4326	CLIP-seq
MIRT769999	hsa-miR-4417	CLIP-seq
MIRT770000	hsa-miR-4421	CLIP-seq
MIRT770001	hsa-miR-4445	CLIP-seq
MIRT770002	hsa-miR-4517	CLIP-seq
MIRT770003	hsa-miR-452	CLIP-seq
MIRT770004	hsa-miR-4532	CLIP-seq
MIRT770005	hsa-miR-4539	CLIP-seq
MIRT770006	hsa-miR-4676-3p	CLIP-seq
MIRT770007	hsa-miR-4717-3p	CLIP-seq
MIRT770008	hsa-miR-4753-3p	CLIP-seq
MIRT770009	hsa-miR-4768-5p	CLIP-seq
MIRT770010	hsa-miR-4775	CLIP-seq
MIRT770011	hsa-miR-4776-5p	CLIP-seq
MIRT770012	hsa-miR-4782-3p	CLIP-seq
MIRT770013	hsa-miR-4797-5p	CLIP-seq
MIRT770014	hsa-miR-4802-3p	CLIP-seq
MIRT770015	hsa-miR-508-3p	CLIP-seq
MIRT770016	hsa-miR-548g	CLIP-seq
MIRT770017	hsa-miR-582-5p	CLIP-seq
MIRT770018	hsa-miR-616	CLIP-seq
MIRT770019	hsa-miR-636	CLIP-seq
MIRT770020	hsa-miR-648	CLIP-seq
MIRT770021	hsa-miR-720	CLIP-seq
MIRT770022	hsa-miR-760	CLIP-seq
MIRT770023	hsa-miR-802	CLIP-seq
MIRT770024	hsa-miR-875-3p	CLIP-seq
MIRT770025	hsa-miR-92a	CLIP-seq
MIRT770026	hsa-miR-92b	CLIP-seq
MIRT770027	hsa-miR-935	CLIP-seq
MIRT769972	hsa-miR-137	CLIP-seq
MIRT769977	hsa-miR-218	CLIP-seq
MIRT769980	hsa-miR-25	CLIP-seq
MIRT769983	hsa-miR-32	CLIP-seq
MIRT769988	hsa-miR-3619-3p	CLIP-seq
MIRT769989	hsa-miR-363	CLIP-seq
MIRT769991	hsa-miR-367	CLIP-seq
MIRT769992	hsa-miR-3977	CLIP-seq
MIRT1927089	hsa-miR-4711-5p	CLIP-seq
MIRT770007	hsa-miR-4717-3p	CLIP-seq
MIRT1927090	hsa-miR-4743	CLIP-seq
MIRT770008	hsa-miR-4753-3p	CLIP-seq
MIRT770009	hsa-miR-4768-5p	CLIP-seq
MIRT770011	hsa-miR-4776-5p	CLIP-seq
MIRT770013	hsa-miR-4797-5p	CLIP-seq
MIRT770014	hsa-miR-4802-3p	CLIP-seq
MIRT770019	hsa-miR-636	CLIP-seq
MIRT770025	hsa-miR-92a	CLIP-seq
MIRT770026	hsa-miR-92b	CLIP-seq
MIRT769969	hsa-miR-101	CLIP-seq
MIRT2168021	hsa-miR-141	CLIP-seq
MIRT769974	hsa-miR-144	CLIP-seq
MIRT769975	hsa-miR-19a	CLIP-seq
MIRT769976	hsa-miR-19b	CLIP-seq
MIRT2168022	hsa-miR-200a	CLIP-seq
MIRT2168023	hsa-miR-3613-3p	CLIP-seq
MIRT769994	hsa-miR-4265	CLIP-seq
MIRT769996	hsa-miR-4296	CLIP-seq
MIRT769997	hsa-miR-4322	CLIP-seq
MIRT769999	hsa-miR-4417	CLIP-seq
MIRT2168024	hsa-miR-4444	CLIP-seq
MIRT2168025	hsa-miR-4731-3p	CLIP-seq
MIRT2168026	hsa-miR-4801	CLIP-seq
MIRT2168027	hsa-miR-548aa	CLIP-seq
MIRT2168028	hsa-miR-548ac	CLIP-seq
MIRT2168029	hsa-miR-548d-3p	CLIP-seq
MIRT2168030	hsa-miR-548z	CLIP-seq
MIRT770017	hsa-miR-582-5p	CLIP-seq
MIRT770027	hsa-miR-935	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IEA
GO:0001997	Process	Positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA
GO:0002024	Process	Diet induced thermogenesis	IEA
GO:0002025	Process	Norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IBA
GO:0002025	Process	Norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004939	Function	Beta-adrenergic receptor activity	TAS	8892658
GO:0004940	Function	Beta1-adrenergic receptor activity	IBA
GO:0004940	Function	Beta1-adrenergic receptor activity	IDA	10212248, 12391161
GO:0004940	Function	Beta1-adrenergic receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	12391161, 16316992, 16533813, 23291003, 23381222
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21540189
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10212248, 11526121, 21540189
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0009409	Process	Response to cold	IEA
GO:0016020	Component	Membrane	IEA
GO:0030165	Function	PDZ domain binding	IPI	11526121
GO:0031649	Process	Heat generation	IEA
GO:0031694	Function	Alpha-2A adrenergic receptor binding	IPI	12529373
GO:0040015	Process	Negative regulation of multicellular organism growth	IEA
GO:0042596	Process	Fear response	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IMP	25083013
GO:0045823	Process	Positive regulation of heart contraction	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	12529373
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IDA	10212248, 12391161, 12529373
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0099579	Function	G protein-coupled neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	12387862, 22728333

MIM	HGNC	e!Ensembl
109630	285	ENSG00000043591

P08588

Protein name

Beta-1 adrenergic receptor (Beta-1 adrenoreceptor) (Beta-1 adrenoceptor)

Protein function

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G

PDB

2LSQ , 7BTS , 7BU6 , 7BU7 , 7BVQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	75 → 377	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Sequence length

477

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
SHORT SLEEP, FAMILIAL NATURAL, 2	Pathogenic	rs776439595	RCV000851538	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (33)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ADRB1-related disorder	Likely benign; association; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAUCHER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Resting heart rate	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (158)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	16189366, 26602751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16671086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	21617318, 22664639, 37102236, 38138160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24371822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20384459, 22192668, 22617224, 24332148, 24910551, 29754666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20625396, 22192668, 22499333, 24159564, 24332148, 24982877, 34270905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31276517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29230810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	29587766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25849179, 28031536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33234738, 34930307, 35113855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	20426789	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22797009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	18075464, 18155231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	21617318, 37102236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	22685168	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26796036, 31276517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	12197595, 1327038, 18776959, 21617318, 22664639, 30468641, 8593450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	22685168	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	12197595, 22685168, 22811559, 30468641, 30539571, 31276517		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	12197595, 17667029, 18776959		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	9554809		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12197595, 15850564, 17628514, 19356507, 21553224, 21617318, 22811559, 29209317, 30468641, 31276517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	9554809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	16728691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	11436944		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16120061, 16815314, 19673943, 24371822, 26248277, 29750638, 30837872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18219297		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22664639, 24371822, 24982877, 27645110	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	28351962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	39826584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18615004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	24556804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	17200711, 21395649, 22760495, 23115322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30355907, 30459608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	28746336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11052857, 11964375, 12034720, 12197595, 12422153, 12921807, 14502278, 15735607, 16844790, 17200711, 17496726, 17628514, 1811054, 18158268, 18615004 View all (30 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	12374873, 14502278, 15816327, 21516734, 7586371		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18413560, 28060734, 28635302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12383575, 16421173, 18413560, 18534365, 18615004, 24201118, 24342311, 30668166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18413560, 21880673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	26602751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	28746336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29435917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18797399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	18797399, 24758696		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Gestational	Gestational diabetes	Pubtator	21806475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	18378355		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	20731869, 24972470	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18239290, 24972470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	30582290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12359989, 16815314, 18298953, 19094446, 19673943, 19743955, 23588958, 25291495, 25823457, 29750638		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	15237695, 29549925	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ganglioneuroma	Ganglioneuroma	BEFREE	31524241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	36450729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16785856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	16785856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	16785856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22811559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	16728691, 27884156, 37102236, 38138160, 8522688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22685168, 22811559, 26408610, 29466489, 30539571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11052857, 11964375, 12034720, 12197595, 12921807, 14502278, 15735607, 16844790, 17496726, 17628514, 1811054, 18158268, 18615004, 18947427, 19477404 View all (25 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	12034720, 12197595, 12374873, 12921807, 15237695, 17200711, 1811054, 18615004, 18947427, 19628119, 20521014, 21395649, 22664639, 23115322, 24151242 View all (11 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	12374873, 14502278, 15816327, 21516734, 7586371		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	8522688	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure Systolic	Heart failure	Pubtator	22499333, 25638254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	12374873, 14502278, 15816327, 21516734, 7586371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	34590496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	27211551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	27211551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	24823730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35113855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17003101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	30753253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	LHGDN	17345787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	CTD_human_DG	17345787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	15055253, 15237695, 18615004, 20044737, 21806475, 24552127, 25823457, 27645110, 29549925, 30753253, 36897672, 37952358	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	20216086	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	18187665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	10673262, 9260993		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11447084, 12844134, 16815314, 17094780, 17335470, 17635183, 18615004, 19673943, 19743955, 21444836, 22621216, 23271137, 25823457, 27829563, 28000860, 29027816, 29549925, 8104754 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	18298953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31808213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	20731869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	20731869, 24982877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	24793904, 28734628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HYPOPLASTIC LEFT HEART SYNDROME 1	Hypoplastic Left Heart Syndrome	BEFREE	24793904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	37952358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	24552127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28746336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23370410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18239290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	22685168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25510377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12455717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11910301, 12359989, 14700505, 18298953, 20731869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	18298953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	18158268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	12374873, 14502278, 15816327, 21516734, 7586371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35983976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	11310586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	16785856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35113855, 38066059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	12815745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25849179, 28031536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17003101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20426789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	32586526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18996182, 23318885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18797399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	18797399, 24758696		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	24972470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	24670922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	12815745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	12815745, 16526032		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	17981009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	33619882	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	12374873, 14502278, 15816327, 21516734, 7586371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17680533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18331634, 18615004, 21626217, 28060734, 28456594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18331634, 19623647, 20731869, 37102236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	LHGDN	18413560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28060734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	9554809		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	29209317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23585898, 27211551, 31624248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	19745105	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	28746336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	12032746		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	16534528, 17335470, 17512307, 18059082, 18239290, 29587766, 8994185		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18239290, 29587766, 32398726	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	30569177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	30569177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	30153111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20037603, 22797009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	23103827		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33593484, 35113855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	29027816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30355907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21187140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	19623647, 21626217, 26258721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	28635302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17003101		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	23370410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39826584	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	16728691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	12197595, 37102236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	LHGDN	12197595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	24982877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	24322971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	16844790, 23794609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	12815745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	34590496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	18534365, 21617318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	20731869, 36926933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Premature Complexes	Ventricular ectopy	Pubtator	37102236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADRB1 (adrenoceptor beta 1)