ADRA1D (adrenoceptor alpha 1D)

Gene

• Entrez ID: 146
• Gene name: Adrenoceptor alpha 1D
• Gene symbol: ADRA1D
• Synonyms (NCBI Gene): ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
• Chromosome: 20
• Chromosome location: 20p13
• Summary: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT769806	hsa-miR-1261	CLIP-seq
MIRT769807	hsa-miR-3120-3p	CLIP-seq
MIRT769808	hsa-miR-3184	CLIP-seq
MIRT769809	hsa-miR-423-5p	CLIP-seq
MIRT769810	hsa-miR-4263	CLIP-seq
MIRT769811	hsa-miR-4287	CLIP-seq
MIRT769812	hsa-miR-4469	CLIP-seq
MIRT769813	hsa-miR-4641	CLIP-seq
MIRT769814	hsa-miR-4685-3p	CLIP-seq
MIRT769815	hsa-miR-4779	CLIP-seq
MIRT769816	hsa-miR-490-5p	CLIP-seq
MIRT1927075	hsa-miR-4715-3p	CLIP-seq
MIRT2167979	hsa-miR-486-3p	CLIP-seq
MIRT2383975	hsa-miR-125a-3p	CLIP-seq
MIRT2383976	hsa-miR-4640-5p	CLIP-seq
MIRT2383977	hsa-miR-4726-5p	CLIP-seq
MIRT769808	hsa-miR-3184	CLIP-seq
MIRT769809	hsa-miR-423-5p	CLIP-seq
MIRT2443288	hsa-miR-4688	CLIP-seq
MIRT769815	hsa-miR-4779	CLIP-seq
MIRT2167979	hsa-miR-486-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	10820200
GO:0005515	Function	Protein binding	IPI	16533813, 18468998, 21115837, 24550280, 26460884, 26617989, 27382054
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7746284
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1656955
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	1656955
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10860850
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	14645668, 26617989, 27382054
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0150099	Process	Neuron-glial cell signaling	ISS

Other IDs

• MIM: 104219
• HGNC: 280
• e!Ensembl: ENSG00000171873

Protein

• UniProt ID: P25100
• Protein name: Alpha-1D adrenergic receptor (Alpha-1A adrenergic receptor) (Alpha-1D adrenoreceptor) (Alpha-1D adrenoceptor) (Alpha-adrenergic receptor 1a)
• Protein function: This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	113 → 402	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
  SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
  VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
  TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
  PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
  EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
  WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
  CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
  QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
  AVSLGVPHEVAEGATCQAYELADYSNLRETDI

• Sequence length: 572

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alloimmunisation	Alloimmunisation	BEFREE	15713129		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	28769553, 29175361		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36776063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30529785		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	15713129, 31408202		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25481381, 31452791		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	BEFREE	29634605		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12080381		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15269150		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28081170		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	12442007		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11433198		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	37679988	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28352666		★☆☆☆☆ Found in Text Mining only
Delusional disorder	Delusional Disorder	BEFREE	29081418		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	36776063	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16210358		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	20506560		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15269150		★☆☆☆☆ Found in Text Mining only
Generalized Epilepsy with Febrile Seizures Plus	Generalized Epilepsy With Febrile Seizures Plus	BEFREE	15263074, 16210358		★☆☆☆☆ Found in Text Mining only
GENERALIZED EPILEPSY WITH FEBRILE SEIZURES PLUS, TYPE 2	Epilepsy With Febrile Seizures Plus	BEFREE	16210358		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33806345, 40184918	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40184918	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	24465776	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18468998, 22615923, 24465776, 24548768, 31607175		★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	15263074, 16210358, 20506560		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	12442007		★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	10050970		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	18257748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12080381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25481381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28978122		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30063847		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	17273809		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24173768	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	24173768	Associate	★☆☆☆☆ Found in Text Mining only
Oculo-dento-digital syndrome	Oculodentodigital dysplasia	BEFREE	15108203		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	15592793		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25481381		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25481381	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16043131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26381449	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28978122, 31452791		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	21299476	Associate	★☆☆☆☆ Found in Text Mining only