ADRA1A (adrenoceptor alpha 1A)

Gene

• Entrez ID: 148
• Gene name: Adrenoceptor alpha 1A
• Gene symbol: ADRA1A
• Synonyms (NCBI Gene): ADRA1C, ADRA1L1, ALPHA1AAR
• Chromosome: 8
• Chromosome location: 8p21.2
• Summary: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041983	hsa-miR-484	CLASH	23622248
MIRT769775	hsa-miR-105	CLIP-seq
MIRT769776	hsa-miR-199a-3p	CLIP-seq
MIRT769777	hsa-miR-199b-3p	CLIP-seq
MIRT769778	hsa-miR-223	CLIP-seq
MIRT769779	hsa-miR-3129-5p	CLIP-seq
MIRT769780	hsa-miR-323b-5p	CLIP-seq
MIRT769781	hsa-miR-3545-3p	CLIP-seq
MIRT769782	hsa-miR-4474-3p	CLIP-seq
MIRT769783	hsa-miR-4539	CLIP-seq
MIRT769784	hsa-miR-4687-3p	CLIP-seq
MIRT769785	hsa-miR-4697-3p	CLIP-seq
MIRT769786	hsa-miR-582-3p	CLIP-seq
MIRT769787	hsa-miR-936	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769803	hsa-miR-564	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq
MIRT2470513	hsa-miR-579	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	10520459
SP1	Unknown	10520459
TFAP2A	Unknown	10520459

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001985	Process	Negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IEA
GO:0001997	Process	Positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	NAS	9490024
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	7737411
GO:0005515	Function	Protein binding	IPI	20508391, 24567387
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8396931
GO:0005901	Component	Caveola	IEA
GO:0006915	Process	Apoptotic process	TAS	10671514
GO:0006937	Process	Regulation of muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	8183249
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8396931
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10860850
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	8396931
GO:0007512	Process	Adult heart development	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10860850
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0009725	Process	Response to hormone	ISS
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0031965	Component	Nuclear membrane	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	ISS
GO:0035265	Process	Organ growth	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	10671514
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045760	Process	Positive regulation of action potential	ISS
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0071875	Process	Adrenergic receptor signaling pathway	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0071882	Process	Phospholipase C-activating adrenergic receptor signaling pathway	ISS
GO:0097195	Process	Pilomotor reflex	IEA
GO:0150099	Process	Neuron-glial cell signaling	IEA
GO:0150099	Process	Neuron-glial cell signaling	ISS

Other IDs

• MIM: 104221
• HGNC: 277
• e!Ensembl: ENSG00000120907

Protein

• UniProt ID: P35348
• Protein name: Alpha-1A adrenergic receptor (Alpha-1A adrenoreceptor) (Alpha-1A adrenoceptor) (Alpha-1C adrenergic receptor) (Alpha-adrenergic receptor 1c)
• Protein function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu
• PDB: 7YM8, 7YMH, 7YMJ, 8HN1, 8THK, 8THL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 326	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in
• Sequence:

  MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
  THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
  SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
  EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
  APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
  FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
  HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
  TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV

• Sequence length: 466

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrodysostosis	Acrodysostosis	BEFREE	22723333, 23043190		★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8702478		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27588474, 28428987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29971639		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28653505		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26827652	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	11027943, 29393391		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19247167, 30576947		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11728229, 15764725, 15947423, 17154652, 18588753, 20705147, 21392828, 28754608, 30335499		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	34184773	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	11326305, 19352218, 21499268, 22897819, 28912643, 28948080		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12086852, 25293589, 25354317, 30409535, 30510193, 30827936		★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypocalcemia	Hypocalcemia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Bartter Disease	Bartter syndrome	BEFREE	27339034		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15136785, 16536786, 18386288, 31452791, 8832064		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16894394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	29508437		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29949238		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11897506, 16397244, 19584257, 19622769, 23500535, 24599592, 26985934, 28209621, 30760632, 9367686		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	30670596		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24160375	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24607627, 31933413, 34706275	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22715397, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31140607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25172843		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10537322, 17442564, 19010824, 19331211		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28081170		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26248277, 29166798, 29848777, 31236974		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31554915		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31554915	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	25001852		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31785110		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21936770		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28877377, 30811196		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31132237		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20979106, 29971639		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25701758, 28875496		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974, 31785110		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28870781		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23969937, 31140607		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	16687567, 16926383, 17028442, 18161478, 21467199		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27471203		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17324522	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	26576537		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21392828		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21392828, 28358422		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19476565		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18037923, 20816753, 23226241, 24946790, 28105282, 28363772, 28734639, 29466332, 29684031, 30154102		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	12107237		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	19331211		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16239258, 23235274		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35832124	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23458722		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	26854024		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17442564, 19331211		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28627033		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	16685204, 25732908		★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	20846291		★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	28531963		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28233865		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	16782692		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	12707939		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17611713, 21503828, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17611713, 21503828, 21900396, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18991757, 30638950		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23039881		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30541874		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	10087195		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	8001158		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20708032, 8626439		★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis, Non-Immune	Hydrops Fetalis	BEFREE	30115739		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28338186		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29022064		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19105822, 20044737, 36012699, 36831252	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15225142, 16439609, 16481879, 18370232, 24548768, 25150869, 28412414, 30075183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16685204, 19011682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	9353275	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29669745		★☆☆☆☆ Found in Text Mining only
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	15598687, 17164310		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	30975883		★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 8	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	15598687		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36499685	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31272268		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25937634		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	18285834, 24830383		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10364352, 10438939, 10662620, 11289142, 11418689, 11504542, 12620408, 15003988, 16904612, 17329974, 17483315, 17881360, 18802460, 19915163, 20213674, 20660728, 20818438, 21159881, 21559457, 22942256, 23269549, 24292677, 28161489, 30308321, 31838186, 8892957		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28596381, 30305310		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	18257748		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15097244		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15143072		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15039279, 26220344, 28428987, 30223538, 31032748		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17259344, 24160375, 24607627, 29704239, 30061721		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	16782692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	17259344		★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long QT Syndrome	BEFREE	19419905		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25640674, 28273093		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19138979, 20686609, 28653505		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8892957		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20493668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20493668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	11897506, 16397244, 19584257, 22927430, 23500535, 24599592, 26985934, 30760632, 9367686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16239258, 23235274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22715397, 25744720, 26462152, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10537322, 19010824		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 28768769, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15650023, 17130136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11832457, 15492257, 17188489, 19726788, 19755124, 21084381, 21159881, 22942256, 23269549, 23497290, 23500535, 24508914, 24599592, 25970609, 26854063, 26893368, 27601164, 27715394, 28223438, 28618224, 28673732, 29165389, 29268141, 29483837, 29614094, 29921886, 30510193, 30559168, 30775647, 31496800, 31500846, 31630880, 31659944, 31787357		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20979106, 29971639		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15322701, 18583061, 19338054, 22273393, 28223438, 30267482		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27046448		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25364818		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25246581, 27215467, 28691227, 29655980		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21519279		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28229904		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	30482667		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22591013		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28052250, 30131588		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28412414, 28798316		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11289142, 12150333, 12620408, 17894856, 20855608, 21102457, 21385899, 21559457, 22942256, 23269549, 23651229, 23979133, 24853422, 24882516, 25174588, 25194819, 25434383, 25701758, 27248167, 28152577, 29704239, 29749524, 31168089, 9284742		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	12824183		★☆☆☆☆ Found in Text Mining only
Nephrogenic Syndrome of Inappropriate Antidiuresis	Nephrogenic Syndrome Of Inappropriate Antidiuresis	BEFREE	31486901		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31025859		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	9353275	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21299846		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23144692, 27669169		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10903341, 18037923, 20462274, 24946790, 25970609, 31002796, 31288724		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36831252	Associate	★☆☆☆☆ Found in Text Mining only
Ocular albinism, type I	Ocular albinism	BEFREE	16646960, 31275171		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28673732, 29277692, 30975883		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10537322, 19010824		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26941397		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	27760455		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30993114		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	22333914, 23754170		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27588474		★☆☆☆☆ Found in Text Mining only
Priapism	Priapism	BEFREE	29394072		★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	15136785		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	8832064		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	9353275	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	8832064		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11593396		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12782672		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19763272	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	BEFREE	29387507		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	11858796		★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	33166306	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27297948		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25216639		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	19955366, 27694816		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11247813, 8889552		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10094932, 15225142		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	17408692, 21784156		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10940760, 16043131, 17408692, 19918262, 20158934, 21302347, 21784156, 22037178, 28763059, 29497362, 30710087, 31704949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21302347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34184773	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	21618827		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30503722		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	15274044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18057535		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24568968		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28233865		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23344946		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29025761		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18451066		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	15225142		★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24599592		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30872391		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	20493668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	18719078, 27089179, 28223438, 30352874		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30586762		★☆☆☆☆ Found in Text Mining only
Vibratory urticaria	Vibratory urticaria	BEFREE	29454835		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 1	von Willebrand disorder	BEFREE	26630678		★☆☆☆☆ Found in Text Mining only