ADM5 (adrenomedullin 5 (putative))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 199800
Gene name Adrenomedullin 5 (putative)
Gene symbol ADM5
Synonyms (NCBI Gene)
AM5C19orf76
Chromosome 19
Chromosome location 19q13.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003073 Process Regulation of systemic arterial blood pressure IBA
GO:0005576 Component Extracellular region IEA
GO:0007189 Process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IBA
GO:0010460 Process Positive regulation of heart rate IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621171 27293 ENSG00000224420
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
C9JUS6
Protein name Putative adrenomedullin-5-like protein
Protein function Probable non-functional remnant of adrenomedullin-5.
Family and domains
Sequence 
MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLH
QGALGEGQPRAPGPLQLWAPPVARGGSPARFPGFRPAARGLAQCPARWVTSGTARPLLGF
SLPICMLELLLHISSPLTPAPETVFPSPSPGCD
Sequence length 153
Interactions View interactions

No strongly related genes found yet for ADM5.

No additional diseases found yet through genes similar to ADM5.