Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	51094
Gene name	Adiponectin receptor 1
Gene symbol	ADIPOR1
Synonyms (NCBI Gene)	ACDCR1CGI-45CGI45PAQR1TESBP1A
Chromosome	1
Chromosome location	1q32.1
Summary	This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase

259

Show/Hide all (259)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048047	hsa-miR-197-3p	CLASH	23622248
MIRT441261	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT441261	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT768907	hsa-miR-1254	CLIP-seq
MIRT768908	hsa-miR-127-5p	CLIP-seq
MIRT768909	hsa-miR-1278	CLIP-seq
MIRT768910	hsa-miR-1294	CLIP-seq
MIRT768911	hsa-miR-221	CLIP-seq
MIRT768912	hsa-miR-222	CLIP-seq
MIRT768913	hsa-miR-3116	CLIP-seq
MIRT768914	hsa-miR-3119	CLIP-seq
MIRT768915	hsa-miR-3184	CLIP-seq
MIRT768916	hsa-miR-3649	CLIP-seq
MIRT768917	hsa-miR-3690	CLIP-seq
MIRT768918	hsa-miR-3973	CLIP-seq
MIRT768919	hsa-miR-410	CLIP-seq
MIRT768920	hsa-miR-423-5p	CLIP-seq
MIRT768921	hsa-miR-4316	CLIP-seq
MIRT768922	hsa-miR-4426	CLIP-seq
MIRT768923	hsa-miR-4635	CLIP-seq
MIRT768924	hsa-miR-4638-3p	CLIP-seq
MIRT768925	hsa-miR-4647	CLIP-seq
MIRT768926	hsa-miR-4662b	CLIP-seq
MIRT768927	hsa-miR-4677-3p	CLIP-seq
MIRT768928	hsa-miR-4679	CLIP-seq
MIRT768929	hsa-miR-4786-3p	CLIP-seq
MIRT768930	hsa-miR-520g	CLIP-seq
MIRT768931	hsa-miR-520h	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT768933	hsa-miR-548k	CLIP-seq
MIRT768934	hsa-miR-548n	CLIP-seq
MIRT768935	hsa-miR-548t	CLIP-seq
MIRT768936	hsa-miR-548v	CLIP-seq
MIRT768937	hsa-miR-593	CLIP-seq
MIRT768938	hsa-miR-595	CLIP-seq
MIRT768939	hsa-miR-603	CLIP-seq
MIRT768940	hsa-miR-607	CLIP-seq
MIRT768941	hsa-miR-648	CLIP-seq
MIRT768907	hsa-miR-1254	CLIP-seq
MIRT768908	hsa-miR-127-5p	CLIP-seq
MIRT768909	hsa-miR-1278	CLIP-seq
MIRT768910	hsa-miR-1294	CLIP-seq
MIRT768913	hsa-miR-3116	CLIP-seq
MIRT768942	hsa-miR-3143	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT768944	hsa-miR-3180-5p	CLIP-seq
MIRT768945	hsa-miR-3182	CLIP-seq
MIRT768915	hsa-miR-3184	CLIP-seq
MIRT768946	hsa-miR-320a	CLIP-seq
MIRT768947	hsa-miR-320b	CLIP-seq
MIRT768948	hsa-miR-320c	CLIP-seq
MIRT768949	hsa-miR-320d	CLIP-seq
MIRT768916	hsa-miR-3649	CLIP-seq
MIRT768950	hsa-miR-3686	CLIP-seq
MIRT768917	hsa-miR-3690	CLIP-seq
MIRT768951	hsa-miR-376c	CLIP-seq
MIRT768920	hsa-miR-423-5p	CLIP-seq
MIRT768921	hsa-miR-4316	CLIP-seq
MIRT768922	hsa-miR-4426	CLIP-seq
MIRT768952	hsa-miR-4429	CLIP-seq
MIRT768953	hsa-miR-4443	CLIP-seq
MIRT768954	hsa-miR-4446-5p	CLIP-seq
MIRT768955	hsa-miR-4452	CLIP-seq
MIRT768956	hsa-miR-4477a	CLIP-seq
MIRT768957	hsa-miR-4480	CLIP-seq
MIRT768958	hsa-miR-455-3p	CLIP-seq
MIRT768923	hsa-miR-4635	CLIP-seq
MIRT768924	hsa-miR-4638-3p	CLIP-seq
MIRT768959	hsa-miR-4645-5p	CLIP-seq
MIRT768925	hsa-miR-4647	CLIP-seq
MIRT768960	hsa-miR-4659a-3p	CLIP-seq
MIRT768961	hsa-miR-4659b-3p	CLIP-seq
MIRT768926	hsa-miR-4662b	CLIP-seq
MIRT768962	hsa-miR-4673	CLIP-seq
MIRT768927	hsa-miR-4677-3p	CLIP-seq
MIRT768928	hsa-miR-4679	CLIP-seq
MIRT768963	hsa-miR-4684-5p	CLIP-seq
MIRT768964	hsa-miR-4698	CLIP-seq
MIRT768965	hsa-miR-4709-3p	CLIP-seq
MIRT768966	hsa-miR-4711-3p	CLIP-seq
MIRT768967	hsa-miR-4711-5p	CLIP-seq
MIRT768968	hsa-miR-4762-3p	CLIP-seq
MIRT768969	hsa-miR-4775	CLIP-seq
MIRT768970	hsa-miR-4777-5p	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT768929	hsa-miR-4786-3p	CLIP-seq
MIRT768972	hsa-miR-518d-5p	CLIP-seq
MIRT768973	hsa-miR-519b-5p	CLIP-seq
MIRT768974	hsa-miR-519c-5p	CLIP-seq
MIRT768975	hsa-miR-520a-5p	CLIP-seq
MIRT768976	hsa-miR-520c-5p	CLIP-seq
MIRT768977	hsa-miR-522	CLIP-seq
MIRT768978	hsa-miR-525-5p	CLIP-seq
MIRT768979	hsa-miR-526a	CLIP-seq
MIRT768980	hsa-miR-590-3p	CLIP-seq
MIRT768937	hsa-miR-593	CLIP-seq
MIRT768939	hsa-miR-603	CLIP-seq
MIRT768981	hsa-miR-765	CLIP-seq
MIRT768908	hsa-miR-127-5p	CLIP-seq
MIRT1926738	hsa-miR-137	CLIP-seq
MIRT1926739	hsa-miR-1587	CLIP-seq
MIRT1926740	hsa-miR-2355-5p	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT1926741	hsa-miR-3189-5p	CLIP-seq
MIRT1926742	hsa-miR-4312	CLIP-seq
MIRT1926743	hsa-miR-4417	CLIP-seq
MIRT1926744	hsa-miR-4453	CLIP-seq
MIRT1926745	hsa-miR-4455	CLIP-seq
MIRT1926746	hsa-miR-4492	CLIP-seq
MIRT1926747	hsa-miR-4498	CLIP-seq
MIRT1926748	hsa-miR-4538	CLIP-seq
MIRT1926749	hsa-miR-4656	CLIP-seq
MIRT768960	hsa-miR-4659a-3p	CLIP-seq
MIRT768961	hsa-miR-4659b-3p	CLIP-seq
MIRT1926750	hsa-miR-4663	CLIP-seq
MIRT1926751	hsa-miR-4675	CLIP-seq
MIRT1926752	hsa-miR-4689	CLIP-seq
MIRT1926753	hsa-miR-4741	CLIP-seq
MIRT1926754	hsa-miR-4758-3p	CLIP-seq
MIRT1926755	hsa-miR-4779	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT1926756	hsa-miR-4796-3p	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT1926757	hsa-miR-591	CLIP-seq
MIRT1926758	hsa-miR-609	CLIP-seq
MIRT1926759	hsa-miR-628-5p	CLIP-seq
MIRT1926760	hsa-miR-762	CLIP-seq
MIRT768909	hsa-miR-1278	CLIP-seq
MIRT768910	hsa-miR-1294	CLIP-seq
MIRT2167719	hsa-miR-3074-5p	CLIP-seq
MIRT768942	hsa-miR-3143	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT768944	hsa-miR-3180-5p	CLIP-seq
MIRT768945	hsa-miR-3182	CLIP-seq
MIRT2167720	hsa-miR-3183	CLIP-seq
MIRT768915	hsa-miR-3184	CLIP-seq
MIRT768916	hsa-miR-3649	CLIP-seq
MIRT768950	hsa-miR-3686	CLIP-seq
MIRT2167721	hsa-miR-370	CLIP-seq
MIRT768951	hsa-miR-376c	CLIP-seq
MIRT768918	hsa-miR-3973	CLIP-seq
MIRT768919	hsa-miR-410	CLIP-seq
MIRT768920	hsa-miR-423-5p	CLIP-seq
MIRT768921	hsa-miR-4316	CLIP-seq
MIRT768922	hsa-miR-4426	CLIP-seq
MIRT768956	hsa-miR-4477a	CLIP-seq
MIRT768959	hsa-miR-4645-5p	CLIP-seq
MIRT768925	hsa-miR-4647	CLIP-seq
MIRT768960	hsa-miR-4659a-3p	CLIP-seq
MIRT768961	hsa-miR-4659b-3p	CLIP-seq
MIRT768926	hsa-miR-4662b	CLIP-seq
MIRT768962	hsa-miR-4673	CLIP-seq
MIRT768927	hsa-miR-4677-3p	CLIP-seq
MIRT768928	hsa-miR-4679	CLIP-seq
MIRT768967	hsa-miR-4711-5p	CLIP-seq
MIRT2167722	hsa-miR-4723-3p	CLIP-seq
MIRT768968	hsa-miR-4762-3p	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT768975	hsa-miR-520a-5p	CLIP-seq
MIRT768930	hsa-miR-520g	CLIP-seq
MIRT768931	hsa-miR-520h	CLIP-seq
MIRT768978	hsa-miR-525-5p	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT768933	hsa-miR-548k	CLIP-seq
MIRT768937	hsa-miR-593	CLIP-seq
MIRT1926740	hsa-miR-2355-5p	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT1926741	hsa-miR-3189-5p	CLIP-seq
MIRT1926742	hsa-miR-4312	CLIP-seq
MIRT1926750	hsa-miR-4663	CLIP-seq
MIRT1926752	hsa-miR-4689	CLIP-seq
MIRT1926754	hsa-miR-4758-3p	CLIP-seq
MIRT1926755	hsa-miR-4779	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT1926757	hsa-miR-591	CLIP-seq
MIRT1926759	hsa-miR-628-5p	CLIP-seq
MIRT2470379	hsa-miR-1236	CLIP-seq
MIRT2470380	hsa-miR-1263	CLIP-seq
MIRT768908	hsa-miR-127-5p	CLIP-seq
MIRT768910	hsa-miR-1294	CLIP-seq
MIRT1926738	hsa-miR-137	CLIP-seq
MIRT1926739	hsa-miR-1587	CLIP-seq
MIRT1926740	hsa-miR-2355-5p	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT2167720	hsa-miR-3183	CLIP-seq
MIRT768915	hsa-miR-3184	CLIP-seq
MIRT1926741	hsa-miR-3189-5p	CLIP-seq
MIRT2470381	hsa-miR-3688-3p	CLIP-seq
MIRT2470382	hsa-miR-3978	CLIP-seq
MIRT768920	hsa-miR-423-5p	CLIP-seq
MIRT2470383	hsa-miR-4291	CLIP-seq
MIRT1926742	hsa-miR-4312	CLIP-seq
MIRT768921	hsa-miR-4316	CLIP-seq
MIRT1926743	hsa-miR-4417	CLIP-seq
MIRT1926744	hsa-miR-4453	CLIP-seq
MIRT1926745	hsa-miR-4455	CLIP-seq
MIRT1926746	hsa-miR-4492	CLIP-seq
MIRT2470384	hsa-miR-4494	CLIP-seq
MIRT1926747	hsa-miR-4498	CLIP-seq
MIRT1926748	hsa-miR-4538	CLIP-seq
MIRT1926749	hsa-miR-4656	CLIP-seq
MIRT1926750	hsa-miR-4663	CLIP-seq
MIRT2470385	hsa-miR-4670-3p	CLIP-seq
MIRT1926751	hsa-miR-4675	CLIP-seq
MIRT768927	hsa-miR-4677-3p	CLIP-seq
MIRT768928	hsa-miR-4679	CLIP-seq
MIRT1926752	hsa-miR-4689	CLIP-seq
MIRT2470386	hsa-miR-4694-3p	CLIP-seq
MIRT2167722	hsa-miR-4723-3p	CLIP-seq
MIRT1926753	hsa-miR-4741	CLIP-seq
MIRT1926754	hsa-miR-4758-3p	CLIP-seq
MIRT1926755	hsa-miR-4779	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT1926756	hsa-miR-4796-3p	CLIP-seq
MIRT2470387	hsa-miR-499a-5p	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT2470388	hsa-miR-545	CLIP-seq
MIRT2470389	hsa-miR-561	CLIP-seq
MIRT1926757	hsa-miR-591	CLIP-seq
MIRT768937	hsa-miR-593	CLIP-seq
MIRT1926758	hsa-miR-609	CLIP-seq
MIRT1926759	hsa-miR-628-5p	CLIP-seq
MIRT1926760	hsa-miR-762	CLIP-seq
MIRT768910	hsa-miR-1294	CLIP-seq
MIRT1926738	hsa-miR-137	CLIP-seq
MIRT1926739	hsa-miR-1587	CLIP-seq
MIRT1926740	hsa-miR-2355-5p	CLIP-seq
MIRT768943	hsa-miR-3150b-3p	CLIP-seq
MIRT768915	hsa-miR-3184	CLIP-seq
MIRT1926741	hsa-miR-3189-5p	CLIP-seq
MIRT2470381	hsa-miR-3688-3p	CLIP-seq
MIRT2470382	hsa-miR-3978	CLIP-seq
MIRT768920	hsa-miR-423-5p	CLIP-seq
MIRT1926742	hsa-miR-4312	CLIP-seq
MIRT768921	hsa-miR-4316	CLIP-seq
MIRT1926743	hsa-miR-4417	CLIP-seq
MIRT1926745	hsa-miR-4455	CLIP-seq
MIRT1926746	hsa-miR-4492	CLIP-seq
MIRT1926747	hsa-miR-4498	CLIP-seq
MIRT1926749	hsa-miR-4656	CLIP-seq
MIRT1926750	hsa-miR-4663	CLIP-seq
MIRT1926751	hsa-miR-4675	CLIP-seq
MIRT768927	hsa-miR-4677-3p	CLIP-seq
MIRT768928	hsa-miR-4679	CLIP-seq
MIRT1926752	hsa-miR-4689	CLIP-seq
MIRT2470386	hsa-miR-4694-3p	CLIP-seq
MIRT1926753	hsa-miR-4741	CLIP-seq
MIRT1926754	hsa-miR-4758-3p	CLIP-seq
MIRT1926755	hsa-miR-4779	CLIP-seq
MIRT768971	hsa-miR-4784	CLIP-seq
MIRT1926756	hsa-miR-4796-3p	CLIP-seq
MIRT768932	hsa-miR-532-5p	CLIP-seq
MIRT2470389	hsa-miR-561	CLIP-seq
MIRT1926757	hsa-miR-591	CLIP-seq
MIRT768937	hsa-miR-593	CLIP-seq
MIRT1926758	hsa-miR-609	CLIP-seq
MIRT1926759	hsa-miR-628-5p	CLIP-seq
MIRT1926760	hsa-miR-762	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF3	Repression	20696134
FOXO1	Activation	20125105

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	29190778, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12802337, 19233263
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	12802337
GO:0010633	Process	Negative regulation of epithelial cell migration	IMP	23776679
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	23776679
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0019395	Process	Fatty acid oxidation	IDA	12802337
GO:0019901	Function	Protein kinase binding	IPI	19233263
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0033211	Process	Adiponectin-activated signaling pathway	IBA
GO:0033211	Process	Adiponectin-activated signaling pathway	IDA	12802337
GO:0033211	Process	Adiponectin-activated signaling pathway	IEA
GO:0033211	Process	Adiponectin-activated signaling pathway	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	23776679
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0055100	Function	Adiponectin binding	IDA	12802337
GO:0055100	Function	Adiponectin binding	IEA
GO:0097003	Function	Adipokinetic hormone receptor activity	IDA	12802337
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	23776679

MIM	HGNC	e!Ensembl
607945	24040	ENSG00000159346

Q96A54

Protein name

Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)

Protein function

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:12802337, PubMed:25855295). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-bin

PDB

5LXG , 6KRZ , 6KS0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03006	HlyIII	129 → 352	Haemolysin-III related	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:16044242). Highly expressed in heart and skeletal muscle (PubMed:12802337). Expressed at intermediate level in brain, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes (PubMed:12802337). Wea

Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL

Sequence length

375

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ADIPOR1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (175)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30134922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18313838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21351255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	18313838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27644646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	22653349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adiponectin Deficiency	Adiponectin Deficiency	BEFREE	24096711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19672024, 31572471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22387454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22186245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36527105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29022894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30819183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29988086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29988086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22227293, 25865302, 28262215, 28293385, 29978896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22227293, 25865302, 28262215, 28293385, 29978896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37478258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29861101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	23756394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23756394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	23756394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29179455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	38049739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17123704, 18451143, 19524379, 23776679, 28327197, 28873415, 29311755, 31685042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18451143, 20553615, 20697428, 23750285, 23776679, 28173833, 28327197, 29311755, 33067778, 35846306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30357746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24619866, 35733794, 39849382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25744365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28356549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29603059	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21761356, 31401413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	22653349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28356549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20938443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24586568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	31648632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23860143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	33484170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19549705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	26741812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17697862, 19539174, 25049200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19109202, 22233975, 27003425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25591865, 28258220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18695895, 20444885, 21749709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18827209, 20697428, 21351255, 21749709, 22087284, 25292021, 25422229, 25516230, 26047008, 26931562, 29761507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18310295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18827209, 21749709, 22087284, 25422229, 26931562, 27644646, 36429712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25640382	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	31827477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	31827477	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	36047894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20103776, 24239242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24096711, 28178338, 31401413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17003341, 22534793, 24967709, 25582653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17003341, 21284833, 22534793, 24967709, 25582653, 26741812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17003341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21284833	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24967709, 26741812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17003341, 24967709, 25582653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18395775, 22340319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16756736, 17416799, 17607322, 21289205, 22443353, 24586568, 29304075, 30473057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16756736, 17416799, 17607322, 18097620, 21289205, 22049178, 22443353, 24586568, 29304075, 30473057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17135604, 21289205, 22049178, 22443353, 24586568, 29145541, 31864032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18622492, 21289205, 22049178, 23351195, 24967709, 26741812, 29916530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23922494, 26611106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15105989, 15277397, 15918014, 15983228, 16505255, 16551730, 16724230, 17003341, 17216283, 17716299, 17878241, 18294218, 18466348, 18622492, 19631916 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30135333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29330340, 30135333, 30699330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	18622492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21980131, 22038736, 22327423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21980131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26459399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28356549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	16139921, 17006986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20938443, 23510830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	17006986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29237572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	18310295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24648185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28440504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25049200	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18097620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20696134, 26247729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	15725703, 22442376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26146630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18097620, 26146630, 29115432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	29145541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	29359786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	BEFREE	29359786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29540173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17213476, 17712104, 20032495, 21289205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	29304075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	31833409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	24595307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	25049200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17697862, 19539174, 25049200		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD Syndrome	Leopard syndrome	Pubtator	38049739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30134922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30134922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	26111083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	26111083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28539268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	17006986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17006986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31401413	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25744365, 32570854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22078265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23358237	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17123704, 18451143, 19524379, 23776679, 28327197, 28873415, 29311755, 31685042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21980131, 22038736, 22327423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31534630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25744365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20697428, 21397927, 21960694, 25586350, 26160610, 27768592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17459059, 25270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20336470, 21351255, 21397927, 21960694, 22038736, 25292021, 26047008, 26160610, 28356549, 29761507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18695895, 20444885, 21749709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17123704, 18163210, 18451143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31685042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28963462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	29937410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23510830, 26741812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	27294143, 29145541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20032495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15277397, 16955209, 19887569, 20032495, 23656997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22082804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29524572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	18622492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28940978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18310295, 19672024, 23776679, 24096711, 24648185, 25744365, 26931562, 28356549, 31401413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29335844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30473057, 30879098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29956809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19661131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16493120	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16551730, 16756736, 17135604, 17391161, 17607322, 19887569, 21273992, 22767440, 23805277, 24096711, 24586568, 25591865, 28356549, 29761507, 30732639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17135604, 18854016, 20697428, 21761356, 22038736, 22106445, 28195643, 28356549, 33484170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18442481	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	19887569	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21194467, 33484170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	24888493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28811200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28811200		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25700032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19051043, 37555827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	22078265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	19672024, 31572471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	19672024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17001470, 24335000, 27075719, 27597432, 28522293, 31661670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	17001470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26631404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	20061428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20697428, 21397927, 21960694, 25586350, 27768592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16899222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21397927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25945502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21749709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31534630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24096711, 28178338, 31401413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	26662040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	26662040, 27655171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18395775, 22340319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	29689708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	22495003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19019483, 20938443, 23510830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17459059, 25270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17459059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22078265, 24969908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	22265003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21937620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	25049200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	25049200	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32396633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30080295		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADIPOR1 (adiponectin receptor 1)