Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	124
Gene name	Alcohol dehydrogenase 1A (class I), alpha polypeptide
Gene symbol	ADH1A
Synonyms (NCBI Gene)	ADH1
Chromosome	4
Chromosome location	4q23
Summary	This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze

miRTarBase ID	miRNA	Experiments	Reference
MIRT021722	hsa-miR-132-3p	Microarray	17612493
MIRT768615	hsa-miR-4468	CLIP-seq
MIRT768616	hsa-miR-4677-3p	CLIP-seq
MIRT768617	hsa-miR-4679	CLIP-seq

Transcription factor	Regulation	Reference
GATA2	Activation	16153155

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	IDA	9982, 2738060
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IBA
GO:0005515	Function	Protein binding	IPI	16153155
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0006066	Process	Alcohol metabolic process	IDA	2738060
GO:0006066	Process	Alcohol metabolic process	NAS	2347582
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0042572	Process	Retinol metabolic process	IBA
GO:0042573	Process	Retinoic acid metabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:1990362	Function	Butanol dehydrogenase (NAD+) activity	IEA

MIM	HGNC	e!Ensembl
103700	249	ENSG00000187758

P07327

Protein name

Alcohol dehydrogenase 1A (EC 1.1.1.1) (Alcohol dehydrogenase subunit alpha)

Protein function

Alcohol dehydrogenase (PubMed:2738060). Oxidizes primary as well as secondary alcohols. Ethanol is a very poor substrate (PubMed:2738060).

PDB

1HSO , 1U3T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00107	ADH_zinc_N	203 → 339	Zinc-binding dehydrogenase	Family
PF08240	ADH_N	34 → 161	Alcohol dehydrogenase GroES-like domain	Domain

Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF

Sequence length

375

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycolysis / Gluconeogenesis	Abacavir metabolism
Fatty acid degradation	RA biosynthesis pathway
Tyrosine metabolism	Ethanol oxidation
Pyruvate metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Alcoholic liver disease

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
Acute myeloid leukemia	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD	35172013	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29071344	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD	29718361	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (41)
Astrocytoma	Astrocytoma	BEFREE	21276435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	23375686, 26818911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypocalcemia	Hypocalcemia	BEFREE	26052899, 29846619, 31063613, 31820785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19077459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28261287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31292488, 33550915	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30653870, 35236335, 36341373, 39193514, 40527777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33287761	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21480392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22045060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADH1B	1	["Liver failure"]	9	["Glycolysis \/ Gluconeogenesis","Fatty acid degradation","Tyrosine metabolism","Pyruvate metabolism","Retinol metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Alcoholic liver disease","Ethanol oxidation"]	2	["CTD (Liver failure)","CTD (Nonalcoholic fatty liver disease)"]
ADH1C	0	[]	10	["Glycolysis \/ Gluconeogenesis","Fatty acid degradation","Tyrosine metabolism","Pyruvate metabolism","Retinol metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Alcoholic liver disease","RA biosynthesis pathway","Ethanol oxidation"]	0	[]
ADH4	0	[]	10	["Glycolysis \/ Gluconeogenesis","Fatty acid degradation","Tyrosine metabolism","Pyruvate metabolism","Retinol metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Alcoholic liver disease","RA biosynthesis pathway","Ethanol oxidation"]	1	["CTD (Nonalcoholic fatty liver disease)"]
ADH6	0	[]	9	["Glycolysis \/ Gluconeogenesis","Fatty acid degradation","Tyrosine metabolism","Pyruvate metabolism","Retinol metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Alcoholic liver disease","Ethanol oxidation"]	0	[]
ADH7	0	[]	9	["Glycolysis \/ Gluconeogenesis","Fatty acid degradation","Tyrosine metabolism","Pyruvate metabolism","Retinol metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Alcoholic liver disease","Ethanol oxidation"]	0	[]

ADH1A (alcohol dehydrogenase 1A (class I), alpha polypeptide)

Bookmark This Gene