ADCK5 (aarF domain containing kinase 5)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 203054
Gene name AarF domain containing kinase 5
Gene symbol ADCK5
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT767779 hsa-miR-1825 CLIP-seq
MIRT767780 hsa-miR-361-3p CLIP-seq
MIRT767781 hsa-miR-371b-3p CLIP-seq
MIRT767782 hsa-miR-3943 CLIP-seq
MIRT767782 hsa-miR-3943 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004674 Function Protein serine/threonine kinase activity IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488
GO:0005739 Component Mitochondrion HTP 34800366
GO:0016020 Component Membrane IEA
GO:0016301 Function Kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621165 21738 ENSG00000173137
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3MIX3
Protein name Uncharacterized aarF domain-containing protein kinase 5 (EC 2.7.11.-)
Protein function The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03109 ABC1 188 → 304 ABC1 family Family
Sequence 
MWRPVQLCHFHSALLHSRQKPWPSPAVFFRRNVRGLPPRFSSPTPLWRKVLSTAVVGAPL
LLGARYVMAEAREKRRMRLVVDGMGRFGRSLKVGLQISLDYWWCTNVVLRGVEENSPGYL
EVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGFQ
EVDELFLEDFQALPHELFQEFDYQPIAAASLAQVHRAKLHDGTSVAVKVQYIDLRDRFDG
DIHTLELLLRLVEVMHPSFGFSWVLQDLKGTLAQELDFENEGRNAERCARELAHFPYVVV
PRVHWDKSSKRVLTADFCAGCKVNDVEAIRSQGLAVHDIAEKLIKAFAEQIFYTGFIHSD
PHPGNVLVRKGPDGKAELVLLDHGLYQFLEEKDRAALCQLWRAIILRDDAAMRAHAAALG
VQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARERFEAVMAVLRELPRPMLLV
LRNINTVRAINVALGAPVDRYFLMAKRAVRGWSRLAGATYRGVYGTSLLRHAKVVWEMLK
FEVALRLETLAMRLTALLARALVHLSLVPPAEELYQYLET
Sequence length 580
Interactions View interactions

No strongly related genes found yet for ADCK5.

No additional diseases found yet through genes similar to ADCK5.