ADCK2 (aarF domain containing kinase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 90956
• Gene name: AarF domain containing kinase 2
• Gene symbol: ADCK2
• Synonyms (NCBI Gene): AARF
• Chromosome: 7
• Chromosome location: 7q34

miRNA Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052161	hsa-let-7b-5p	CLASH	23622248
MIRT042051	hsa-miR-484	CLASH	23622248
MIRT040368	hsa-miR-615-3p	CLASH	23622248
MIRT767684	hsa-miR-1252	CLIP-seq
MIRT767685	hsa-miR-125a-5p	CLIP-seq
MIRT767686	hsa-miR-125b	CLIP-seq
MIRT767687	hsa-miR-203	CLIP-seq
MIRT767688	hsa-miR-2467-5p	CLIP-seq
MIRT767689	hsa-miR-3136-3p	CLIP-seq
MIRT767690	hsa-miR-3143	CLIP-seq
MIRT767691	hsa-miR-3657	CLIP-seq
MIRT767692	hsa-miR-3689a-3p	CLIP-seq
MIRT767693	hsa-miR-3689c	CLIP-seq
MIRT767694	hsa-miR-4292	CLIP-seq
MIRT767695	hsa-miR-4308	CLIP-seq
MIRT767696	hsa-miR-4319	CLIP-seq
MIRT767697	hsa-miR-4428	CLIP-seq
MIRT767698	hsa-miR-4446-5p	CLIP-seq
MIRT767699	hsa-miR-4693-3p	CLIP-seq
MIRT767700	hsa-miR-4732-3p	CLIP-seq
MIRT767701	hsa-miR-4755-5p	CLIP-seq
MIRT767702	hsa-miR-4769-3p	CLIP-seq
MIRT767703	hsa-miR-543	CLIP-seq
MIRT767704	hsa-miR-635	CLIP-seq
MIRT767705	hsa-miR-670	CLIP-seq
MIRT1921513	hsa-miR-4691-5p	CLIP-seq
MIRT1921513	hsa-miR-4691-5p	CLIP-seq
MIRT1921513	hsa-miR-4691-5p	CLIP-seq
MIRT1926219	hsa-miR-4667-3p	CLIP-seq
MIRT2167452	hsa-miR-1	CLIP-seq
MIRT2167453	hsa-miR-206	CLIP-seq
MIRT2167454	hsa-miR-3673	CLIP-seq
MIRT2167455	hsa-miR-613	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	27499296
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	31480808, 33988507
GO:0005739	Component	Mitochondrion	IEA
GO:0010795	Process	Regulation of ubiquinone biosynthetic process	IDA	31480808
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA

Other IDs

• MIM: 621162
• HGNC: 19039
• e!Ensembl: ENSG00000133597

Protein

• UniProt ID: Q7Z695
• Protein name: Uncharacterized aarF domain-containing protein kinase 2 (EC 2.7.11.-)
• Protein function: The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr) (Probable). Involved in the mitochondrial import of CoQ precursors, plays a role
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03109	ABC1	284 → 389	ABC1 family	Family

• Sequence:

  MVAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEG
  APDVLSRRRVRCSGAAGAGPAESLPRAGPLGGVFLHLRLWLRAGALLVKFFPLLLLYPLT
  YLAPSVSTLWLHLLLKATETSGPTYIKLGQWASTRRDLFSEAFCAQFSKLHVRVTPHPWT
  HTERFLRQAFGDDWGSILSFENREPVGSGCVAQVYKAYANTAFLETDSVQRLGRASCLPP
  FSHTGAVGGLRELFGYLGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQP
  EATNLISVAVKVLHPGLLAQVHMDLLLMKIGSRVLGVLPGIKWLSLPEIVEEFEKLMVQQ
  IDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPVDL
  KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGANGLSSSQEAQLQQADICDTLVVAV
  PSSLCPLRLVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVE
  GFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGL
  GRSLDPKLDILEAARPFLLTGPVCPP

• Sequence length: 626

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ADCK2-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22355351	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ADCK2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ADCK2.