Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	27299
Gene name	ADAM like decysin 1
Gene symbol	ADAMDEC1
Synonyms (NCBI Gene)	M12.219
Chromosome	8
Chromosome location	8p21.2
Summary	This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	NAS	9271581, 12037602
GO:0005576	Component	Extracellular region	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006955	Process	Immune response	NAS	12037602
GO:0007162	Process	Negative regulation of cell adhesion	NAS	9271581
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	NAS	12037602
GO:0016787	Function	Hydrolase activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606393	16299	ENSG00000134028

O15204

Protein name

ADAM DEC1 (EC 3.4.24.-) (A disintegrin and metalloproteinase domain-like protein decysin-1) (ADAM-like protein decysin-1)

Protein function

May play an important role in the control of the immune response and during pregnancy.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01421	Reprolysin	218 → 412	Reprolysin (M12B) family zinc metalloprotease	Domain
PF01562	Pep_M12B_propep	39 → 173	Reprolysin family propeptide	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Wea

Sequence

MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKN
NQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPEN
MEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQ
DPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTL
IRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGK
KIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGM
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Sequence length

470

Interactions

View interactions

Related Genes Genes most often co-reported with ADAMDEC1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ADAMDEC1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ADAMDEC1 (see Related Genes above), that are NOT already directly curated for ADAMDEC1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ADAMDEC1.

ADAMDEC1 (ADAM like decysin 1)

Save This Analysis