ADAM8 (ADAM metallopeptidase domain 8)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 101
• Gene name: ADAM metallopeptidase domain 8
• Gene symbol: ADAM8
• Synonyms (NCBI Gene): CD156, CD156a, MS2
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019009	hsa-miR-335-5p	Microarray	18185580
MIRT766184	hsa-miR-186	CLIP-seq
MIRT766185	hsa-miR-3133	CLIP-seq
MIRT766186	hsa-miR-3157-5p	CLIP-seq
MIRT766187	hsa-miR-3173-5p	CLIP-seq
MIRT766188	hsa-miR-3189-5p	CLIP-seq
MIRT766189	hsa-miR-329	CLIP-seq
MIRT766190	hsa-miR-362-3p	CLIP-seq
MIRT766191	hsa-miR-3941	CLIP-seq
MIRT766192	hsa-miR-4314	CLIP-seq
MIRT766193	hsa-miR-4450	CLIP-seq
MIRT766194	hsa-miR-4667-5p	CLIP-seq
MIRT766195	hsa-miR-4690-3p	CLIP-seq
MIRT766196	hsa-miR-4700-5p	CLIP-seq
MIRT766197	hsa-miR-4758-3p	CLIP-seq
MIRT766198	hsa-miR-603	CLIP-seq
MIRT766199	hsa-miR-637	CLIP-seq
MIRT766200	hsa-miR-662	CLIP-seq
MIRT766189	hsa-miR-329	CLIP-seq
MIRT766190	hsa-miR-362-3p	CLIP-seq
MIRT766191	hsa-miR-3941	CLIP-seq
MIRT766198	hsa-miR-603	CLIP-seq

Gene ontology (GO) Show/Hide all (89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000902	Process	Cell morphogenesis	ISS
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0002102	Component	Podosome	IDA	15220135
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0002675	Process	Positive regulation of acute inflammatory response	ISS
GO:0002693	Process	Positive regulation of cellular extravasation	IBA
GO:0002693	Process	Positive regulation of cellular extravasation	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	15574124, 17548643, 25825872
GO:0005737	Component	Cytoplasm	IDA	18397961
GO:0005886	Component	Plasma membrane	IDA	17548643, 18397961
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	12777399, 17548643
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	12777399, 15220135, 17548643
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	18397961
GO:0009986	Component	Cell surface	IDA	17548643
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0010954	Process	Positive regulation of protein processing	NAS	17548643
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IBA
GO:0022407	Process	Regulation of cell-cell adhesion	IDA	17548643
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0023061	Process	Signal release	IDA	12777399
GO:0032010	Component	Phagolysosome	IDA	17548643
GO:0032127	Component	Dense core granule membrane	IDA	17548643
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IPI	12777399
GO:0033089	Process	Positive regulation of T cell differentiation in thymus	IEA
GO:0033089	Process	Positive regulation of T cell differentiation in thymus	ISS
GO:0034987	Function	Immunoglobulin receptor binding	IPI	12777399
GO:0035579	Component	Specific granule membrane	TAS
GO:0042581	Component	Specific granule	IDA	17548643
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	ISS
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0045780	Process	Positive regulation of bone resorption	ISS
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045785	Process	Positive regulation of cell adhesion	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048247	Process	Lymphocyte chemotaxis	IEA
GO:0048247	Process	Lymphocyte chemotaxis	ISS
GO:0050714	Process	Positive regulation of protein secretion	IC	17548643
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IBA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	15220135, 17548643
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	IEA
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	ISS
GO:0070820	Component	Tertiary granule	IDA	17548643
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071133	Component	Alpha9-beta1 integrin-ADAM8 complex	IEA
GO:0071133	Component	Alpha9-beta1 integrin-ADAM8 complex	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	18566576
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:2000309	Process	Positive regulation of tumor necrosis factor (ligand) superfamily member 11 production	IEA
GO:2000309	Process	Positive regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS
GO:2000391	Process	Positive regulation of neutrophil extravasation	IDA	17548643
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000415	Process	Positive regulation of fibronectin-dependent thymocyte migration	IEA
GO:2000415	Process	Positive regulation of fibronectin-dependent thymocyte migration	ISS
GO:2000418	Process	Positive regulation of eosinophil migration	IEA
GO:2000418	Process	Positive regulation of eosinophil migration	ISS

Other IDs

• MIM: 602267
• HGNC: 215
• e!Ensembl: ENSG00000151651

Protein

• UniProt ID: P78325
• Protein name: Disintegrin and metalloproteinase domain-containing protein 8 (ADAM 8) (EC 3.4.24.-) (Cell surface antigen MS2) (CD antigen CD156a)
• Protein function: Possible involvement in extravasation of leukocytes.
• PDB: 4DD8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00200	Disintegrin	417 → 489	Disintegrin	Domain
  PF01421	Reprolysin	200 → 400	Reprolysin (M12B) family zinc metalloprotease	Domain
  PF01562	Pep_M12B_propep	26 → 155	Reprolysin family propeptide	Family
  PF08516	ADAM_CR	494 → 572	ADAM cysteine-rich	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed on neutrophils and monocytes.
• Sequence:

  MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYV
  LGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAAS
  LSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGP
  RTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKL
  NFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTT
  VGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAG
  RCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGE
  QCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCD
  GRHPECPEDAFQENGTPCSGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCK
  ASRYRADMCGVLQCKGGQQPLGRAICIVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKG
  RCQDLHVYRSSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPVFVVV
  VLVLLAVVLVTLAGIIVYRKARSRILSRNVAPKTTMGRSNPLFHQAASRVPAKGGAPAPS
  RGPQELVPTTHPGQPARHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQAPKQVIKPTFA
  PPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP

• Sequence length: 824

Pathways

Reactome Pathway

Degradation of the extracellular matrix

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (86)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15623614, 22292754		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17979891		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22959284		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21679521		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17979891		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	35216088	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22433495		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19575316, 28916789, 30910225		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17088949	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17339047, 23837412, 24147597, 24646716		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17339047		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19625177	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19575316, 28916789, 30910225		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	20453887	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30635388		★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	16772875		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24498382, 27039296, 28986926		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25336660, 28467815	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17979891, 25098630	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29247567		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22941466	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15623614, 20453887		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17979891	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22369429	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26522853		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30910225		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	23101757		★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	31305294		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22959284		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31305294		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24147597, 29750543		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27859260, 30384155		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20826683		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	38025763	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25098630		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25098630, 32954649, 33960283, 35103068, 38307957	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719095		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19575316		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30910225		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31640732		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34076249	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	30384155		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25825051, 31142630	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31142630		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31142630		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22467146	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	35767190	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	32372565	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22965687		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22941466	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15623614		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20453887	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34076249	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30635388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24498382, 27039296, 28986926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15623614, 20453887		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17979891, 30945470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17106710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31347325		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17979891, 23193956, 24526468, 24646716, 25098630, 30635388, 30738011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25336660, 28986926		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22959284		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39261477	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29429960		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19575316, 21640993, 28916789, 30910225		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14719095, 15623614, 16772875, 20453887, 22677901, 22959284, 22965687, 25098630, 30635388		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16542157	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22215309, 25481287	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17979891, 30945470		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17979891		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18566576		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17979891, 30861616, 35216088	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17106710		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719095		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18397961, 24646716		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29689251	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22292754		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22369429	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31347325		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22677901	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	18397961		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28261202, 29689251		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25336660, 27039296		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25336660	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30910225		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ADAM8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ADAM8.