ADAM21 (ADAM metallopeptidase domain 21)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8747
• Gene name: ADAM metallopeptidase domain 21
• Gene symbol: ADAM21
• Synonyms (NCBI Gene): ADAM 21, ADAM31
• Chromosome: 14
• Chromosome location: 14q24.2
• Summary: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016846	hsa-miR-335-5p	Microarray	18185580
MIRT766074	hsa-miR-3545-3p	CLIP-seq
MIRT766075	hsa-miR-4536	CLIP-seq
MIRT1925740	hsa-miR-522	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007338	Process	Single fertilization	TAS	9469942
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9469942
GO:0008584	Process	Male gonad development	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030424	Component	Axon	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990913	Component	Sperm head plasma membrane	IBA

Other IDs

• MIM: 603713
• HGNC: 200
• e!Ensembl: ENSG00000139985

Protein

• UniProt ID: Q9UKJ8
• Protein name: Disintegrin and metalloproteinase domain-containing protein 21 (ADAM 21) (EC 3.4.24.-)
• Protein function: May be involved in sperm maturation and/or fertilization. May also be involved in epithelia functions associated with establishing and maintaining gradients of ions or nutrients.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00200	Disintegrin	415 → 487	Disintegrin	Domain
  PF01421	Reprolysin	208 → 398	Reprolysin (M12B) family zinc metalloprotease	Domain
  PF01562	Pep_M12B_propep	34 → 159	Reprolysin family propeptide	Family
  PF08516	ADAM_CR	492 → 605	ADAM cysteine-rich	Family

• Sequence:

  MAVDGTLVYIRVTLLLLWLGVFLSISGYCQAGPSQHFTSPEVVIPLKVISRGRSAKAPGW
  LSYSLRFGGQKHVVHMRVKKLLVSRHLPVFTYTDDRALLEDQLFIPDDCYYHGYVEAAPE
  SLVVFSACFGGFRGVLKISGLTYEIEPIRHSATFEHLVYKINSNETQFPAMRCGLTEKEV
  ARQQLEFEEAENSALEPKSAGDWWTHAWFLELVVVVNHDFFIYSQSNISKVQEDVFLVVN
  IVDSMYKQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFSQWKQISLSQLQHDAAHMFIK
  NSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQHDEEFCFCGE
  RGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKRCGNGVVEREEQC
  DCGSVQQCEQDACCLLNCTLRPGAACAFGLCCKDCKFMPSGELCRQEVNECDLPEWCNGT
  SHQCPEDRYVQDGIPCSDSAYCYQKRCNNHDQHCREIFGKDAKSASQNCYKEINSQGNRF
  GHCGINGTTYLKCHISDVFCGRVQCENVRDIPLLQDHFTLQHTHINGVTCWGIDYHLRMN
  ISDIGEVKDGTVCGPGKICIHKKCVSLSVLSHVCLPETCNMKGICNNKHHCHCGYGWSPP
  YCQHRGYGGSIDSGPASAKRGVFLPLIVIPSLSVLTFLFTVGLLMYLRQCSGPKETKAHS
  SG

• Sequence length: 722

Pathways

Reactome Pathway:

Interaction With Cumulus Cells And The Zona Pellucida

Related Genes

No strongly related genes found yet for ADAM21.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ADAM21.