ADAM2 (ADAM metallopeptidase domain 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2515
Gene name ADAM metallopeptidase domain 2
Gene symbol ADAM2
Synonyms (NCBI Gene)
CRYN1CRYN2CT15FTNBPH-30bPH30PH30-beta
Chromosome 8
Chromosome location 8p11.22
Summary This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017910 hsa-miR-335-5p Microarray 18185580
MIRT766140 hsa-miR-3074-3p CLIP-seq
MIRT766141 hsa-miR-4677-3p CLIP-seq
MIRT766142 hsa-miR-4679 CLIP-seq
MIRT766143 hsa-miR-4789-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004222 Function Metalloendopeptidase activity IBA
GO:0004222 Function Metalloendopeptidase activity IEA
GO:0005178 Function Integrin binding TAS 9041139
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane TAS 9041139
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601533 198 ENSG00000104755
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99965
Protein name Disintegrin and metalloproteinase domain-containing protein 2 (ADAM 2) (Cancer/testis antigen 15) (CT15) (Fertilin subunit beta) (PH-30) (PH30) (PH30-beta)
Protein function Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00200 Disintegrin 393 → 468 Disintegrin Domain
PF01421 Reprolysin 178 → 375 Reprolysin (M12B) family zinc metalloprotease Domain
PF01562 Pep_M12B_propep 14 → 141 Reprolysin family propeptide Family
PF08516 ADAM_CR 473 → 587 ADAM cysteine-rich Family
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Sequence 
MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNL
MQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQF
ENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEPQQDFAKYI
EMHVIVEKQLYNHMGSDTTVVAQKVFQLIGLTNAIFVSFNITIILSSLELWIDENKIATT
GEANELLHTFLRWKTSYLVLRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPR
TISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFA
HFISKQKSQCLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCR
FKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLN
QWICIDGVCMSGDKQCTDTFGKEVEFGPSECYSHLNSKTDVSGNCGISDSGYTQCEADNL
QCGKLICKYVGKFLLQIPRATIIYANISGHLCIAVEFASDHADSQKMWIKDGTSCGSNKV
CRNQRCVSSSYLGYDCTTDKCNDRGVCNNKKHCHCSASYLPPDCSVQSDLWPGGSIDSGN
FPPVAIPARLPERRYIENIYHSKPMRWPFFLFIPFFIIFCVLIAIMVKVNFQRKKWRTED
YSSDEQPESESEPKG
Sequence length 735
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Interaction With Cumulus Cells And The Zona Pellucida

No strongly related genes found yet for ADAM2.

No additional diseases found yet through genes similar to ADAM2.