Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8751
Gene name	ADAM metallopeptidase domain 15
Gene symbol	ADAM15
Synonyms (NCBI Gene)	MDC15
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytoki

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022149	hsa-miR-124-3p	Microarray	18668037
MIRT050739	hsa-miR-18a-5p	CLASH	23622248
MIRT053385	hsa-miR-363-3p	qRT-PCR	23806264
MIRT735210	hsa-miR-3174	qRT-PCR	32547057
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765946	hsa-miR-1247	CLIP-seq
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765948	hsa-miR-147b	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765954	hsa-miR-3667-3p	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT765958	hsa-miR-4652-5p	CLIP-seq
MIRT765959	hsa-miR-4704-3p	CLIP-seq
MIRT765960	hsa-miR-4754	CLIP-seq
MIRT765961	hsa-miR-508-5p	CLIP-seq
MIRT765962	hsa-miR-520a-5p	CLIP-seq
MIRT765963	hsa-miR-525-5p	CLIP-seq
MIRT765964	hsa-miR-566	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT1925697	hsa-miR-593	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq

50 Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IMP	22505472
GO:0002418	Process	Immune response to tumor cell	IDA	22505472
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IMP	22505472
GO:0005515	Function	Protein binding	IPI	10531379, 11741929, 15280379, 16374509, 25416956, 25825872, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0005929	Component	Cilium	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IDA	22505472
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	TAS	9516430
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	22505472
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	12777399
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9516430
GO:0008584	Process	Male gonad development	IEA
GO:0009986	Component	Cell surface	IDA	22505472
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0017124	Function	SH3 domain binding	IPI	10531379
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030308	Process	Negative regulation of cell growth	IMP	22505472
GO:0030336	Process	Negative regulation of cell migration	IMP	22505472
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IPI	12777399
GO:0042246	Process	Tissue regeneration	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	22505472
GO:0046872	Function	Metal ion binding	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0070062	Component	Extracellular exosome	IDA	22505472
GO:0070161	Component	Anchoring junction	IEA
GO:1900121	Process	Negative regulation of receptor binding	IMP	22505472
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IDA	22505472
GO:1990910	Process	Response to hypobaric hypoxia	IEA

MIM	HGNC	e!Ensembl
605548	193	ENSG00000143537

Q13444

Protein name

Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metargidin)

Protein function

Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-med

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00200	Disintegrin	430 → 503	Disintegrin	Domain
PF01421	Reprolysin	213 → 414	Reprolysin (M12B) family zinc metalloprotease	Domain
PF01562	Pep_M12B_propep	29 → 160	Reprolysin family propeptide	Family
PF08516	ADAM_CR	508 → 627	ADAM cysteine-rich	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothe

Sequence

MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKV
LQTSLPEPLRIKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQ
GRVRGYAGSWVSICTCSGLRGLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCA
LSWRESVHTQKPPEHPLGQRHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTL
EVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDL
PGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM
AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQC
RPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQ
PAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSK
CHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLLSLLVLLVLVMLGASYWYRAR
LHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSRPLPPDPVS
KRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA
GIPPLVVPSRPAPPPPTVSSLYL

Sequence length

863

Interactions

View interactions

Reactome Pathway
Degradation of the extracellular matrix
Invadopodia formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
ATRIAL FIBRILLATION	—	GWAS catalog	39537608	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469, 36762574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (63)
Adenocarcinoma	Adenocarcinoma	BEFREE	15756594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16756724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	21190186		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23314034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12858346, 20227692, 22904271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11592366, 16277668, 23918525, 30634456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12858346, 20227692, 22904271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	11839628		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	LHGDN	11839628		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26930657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	16949178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15384173, 19487280, 24317528, 31467400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15565459, 16756724, 18296648, 18434311, 24317528, 31467400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15756594, 21190186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34426560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39346916	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26930657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15756594, 26323669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10513811, 11592366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10513811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10513811	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21190186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11592366, 15818704, 16277668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	15337756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	16894352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16894352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21190186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15384173, 18296648, 19487280, 24317528, 31467400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26323669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17465204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18281484, 19229865, 28282546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26930657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17465204, 17937806, 26323669, 30634456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	15756594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	18296648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18296648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10329602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18695922		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20851104, 23649038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21119930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18281484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39261477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15618016, 15756594, 18281484, 18296648, 21190186, 22677901, 26930657, 28282546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19308291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26323669, 30584356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11592366	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15618016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17465204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23314034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17465204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36504281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18281484, 19229865, 28282546		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18281484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18281484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28282546, 36613831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32677970	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11592366, 16277668, 23918525, 25650586, 30003689, 30634456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29939250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15756594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25475780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22677901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26930657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ADAM15 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ADAM15.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ADAM15 (see Related Genes above), that are NOT already directly curated for ADAM15 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ADAM15.

ADAM15 (ADAM metallopeptidase domain 15)

Bookmark This Gene