ACY3 (aminoacylase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 91703
• Gene name: Aminoacylase 3
• Gene symbol: ACY3
• Synonyms (NCBI Gene): ACY-3, ASPA2, HCBP1
• Chromosome: 11
• Chromosome location: 11q13.2

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004046	Function	Aminoacylase activity	IBA
GO:0004046	Function	Aminoacylase activity	IEA
GO:0004046	Function	Aminoacylase activity	ISS
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 614413
• HGNC: 24104
• e!Ensembl: ENSG00000132744

Protein

• UniProt ID: Q96HD9
• Protein name: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) (EC 3.5.1.114) (Acylase III) (Aminoacylase-3) (ACY-3) (Aspartoacylase-2) (Hepatitis C virus core-binding protein 1) (HCBP1) (HCV core-binding protein 1)
• Protein function: Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04952	AstE_AspA	10 → 301	Succinylglutamate desuccinylase / Aspartoacylase family	Domain

• Sequence:

  MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSG
  CRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTA
  NMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
  PQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLA
  GTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK
  FTFTVPAMPALTPAPSPAS

• Sequence length: 319

Pathways

Reactome Pathway:

Aflatoxin activation and detoxification

Related Genes

No strongly related genes found yet for ACY3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ACY3.