ACTN4 (actinin alpha 4)

Gene

• Entrez ID: 81
• Gene name: Actinin alpha 4
• Gene symbol: ACTN4
• Synonyms (NCBI Gene): ACTININ-4, FSGS, FSGS1
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell type

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs759055242	G>A	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023681	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT051940	hsa-let-7b-5p	CLASH	23622248
MIRT051747	hsa-let-7c-5p	CLASH	23622248
MIRT051105	hsa-miR-16-5p	CLASH	23622248
MIRT050392	hsa-miR-23a-3p	CLASH	23622248
MIRT050151	hsa-miR-26a-5p	CLASH	23622248
MIRT048735	hsa-miR-96-5p	CLASH	23622248
MIRT047208	hsa-miR-182-5p	CLASH	23622248
MIRT046259	hsa-miR-23b-3p	CLASH	23622248
MIRT045364	hsa-miR-185-5p	CLASH	23622248
MIRT044609	hsa-miR-320a	CLASH	23622248
MIRT043999	hsa-miR-378a-5p	CLASH	23622248
MIRT043214	hsa-miR-324-5p	CLASH	23622248
MIRT043003	hsa-miR-324-3p	CLASH	23622248
MIRT042783	hsa-miR-339-5p	CLASH	23622248
MIRT041470	hsa-miR-193b-3p	CLASH	23622248
MIRT040634	hsa-miR-92b-3p	CLASH	23622248
MIRT040028	hsa-miR-615-3p	CLASH	23622248
MIRT039568	hsa-miR-652-3p	CLASH	23622248
MIRT039177	hsa-miR-769-5p	CLASH	23622248
MIRT038369	hsa-miR-296-3p	CLASH	23622248
MIRT037676	hsa-miR-744-5p	CLASH	23622248
MIRT036683	hsa-miR-935	CLASH	23622248
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT082173	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT082189	hsa-miR-548ab	PAR-CLIP	20371350
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT082192	hsa-miR-548ak	PAR-CLIP	20371350
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT082184	hsa-miR-548i	PAR-CLIP	20371350
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT082186	hsa-miR-548w	PAR-CLIP	20371350
MIRT082187	hsa-miR-548y	PAR-CLIP	20371350
MIRT082176	hsa-miR-559	PAR-CLIP	20371350
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT525014	hsa-miR-548k	PAR-CLIP	20371350
MIRT525012	hsa-miR-8054	PAR-CLIP	20371350
MIRT525013	hsa-miR-548l	PAR-CLIP	20371350
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT525011	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	20371350
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT525007	hsa-miR-3921	PAR-CLIP	20371350
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	20371350
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT082173	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT082189	hsa-miR-548ab	PAR-CLIP	21572407
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT082192	hsa-miR-548ak	PAR-CLIP	21572407
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT082184	hsa-miR-548i	PAR-CLIP	21572407
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT082186	hsa-miR-548w	PAR-CLIP	21572407
MIRT082187	hsa-miR-548y	PAR-CLIP	21572407
MIRT082176	hsa-miR-559	PAR-CLIP	21572407
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT525014	hsa-miR-548k	PAR-CLIP	21572407
MIRT525012	hsa-miR-8054	PAR-CLIP	21572407
MIRT525013	hsa-miR-548l	PAR-CLIP	21572407
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT525011	hsa-miR-605-5p	PAR-CLIP	21572407
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	21572407
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	21572407
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	21572407
MIRT525007	hsa-miR-3921	PAR-CLIP	21572407
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	21572407
MIRT082194	hsa-miR-4766-5p	PAR-CLIP	21572407
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT539502	hsa-miR-1295b-5p	PAR-CLIP	22012620
MIRT539501	hsa-miR-1912	PAR-CLIP	22012620
MIRT539500	hsa-miR-1226-3p	PAR-CLIP	22012620
MIRT539499	hsa-miR-4733-3p	PAR-CLIP	22012620
MIRT539498	hsa-miR-3622a-3p	PAR-CLIP	22012620
MIRT539497	hsa-miR-3622b-3p	PAR-CLIP	22012620
MIRT539496	hsa-miR-645	PAR-CLIP	22012620
MIRT539495	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT539494	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT539493	hsa-miR-4750-3p	PAR-CLIP	22012620
MIRT539492	hsa-miR-1180-5p	PAR-CLIP	22012620
MIRT539491	hsa-miR-7114-3p	PAR-CLIP	22012620
MIRT539490	hsa-miR-2115-5p	PAR-CLIP	22012620
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT082173	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT082189	hsa-miR-548ab	PAR-CLIP	23446348
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT082192	hsa-miR-548ak	PAR-CLIP	23446348
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT082184	hsa-miR-548i	PAR-CLIP	23446348
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT082186	hsa-miR-548w	PAR-CLIP	23446348
MIRT082187	hsa-miR-548y	PAR-CLIP	23446348
MIRT082176	hsa-miR-559	PAR-CLIP	23446348
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	23446348
MIRT525014	hsa-miR-548k	PAR-CLIP	23446348
MIRT525012	hsa-miR-8054	PAR-CLIP	23446348
MIRT525013	hsa-miR-548l	PAR-CLIP	23446348
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	23446348
MIRT525011	hsa-miR-605-5p	PAR-CLIP	23446348
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	23446348
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	23446348
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	23446348
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	23446348
MIRT525007	hsa-miR-3921	PAR-CLIP	23446348
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	23446348
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	23446348
MIRT151329	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT728394	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT041470	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT151329	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT735953	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33330445
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT082173	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT082189	hsa-miR-548ab	PAR-CLIP	20371350
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT082192	hsa-miR-548ak	PAR-CLIP	20371350
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT082184	hsa-miR-548i	PAR-CLIP	20371350
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT082186	hsa-miR-548w	PAR-CLIP	20371350
MIRT082187	hsa-miR-548y	PAR-CLIP	20371350
MIRT082176	hsa-miR-559	PAR-CLIP	20371350
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT525014	hsa-miR-548k	PAR-CLIP	20371350
MIRT525012	hsa-miR-8054	PAR-CLIP	20371350
MIRT525013	hsa-miR-548l	PAR-CLIP	20371350
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT525011	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	20371350
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT525007	hsa-miR-3921	PAR-CLIP	20371350
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	20371350
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT082173	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT082189	hsa-miR-548ab	PAR-CLIP	21572407
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT082192	hsa-miR-548ak	PAR-CLIP	21572407
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT082184	hsa-miR-548i	PAR-CLIP	21572407
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT082186	hsa-miR-548w	PAR-CLIP	21572407
MIRT082187	hsa-miR-548y	PAR-CLIP	21572407
MIRT082176	hsa-miR-559	PAR-CLIP	21572407
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT525014	hsa-miR-548k	PAR-CLIP	21572407
MIRT525012	hsa-miR-8054	PAR-CLIP	21572407
MIRT525013	hsa-miR-548l	PAR-CLIP	21572407
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT525011	hsa-miR-605-5p	PAR-CLIP	21572407
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	21572407
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	21572407
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	21572407
MIRT525007	hsa-miR-3921	PAR-CLIP	21572407
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	21572407
MIRT082194	hsa-miR-4766-5p	PAR-CLIP	21572407
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT539502	hsa-miR-1295b-5p	PAR-CLIP	22012620
MIRT539501	hsa-miR-1912	PAR-CLIP	22012620
MIRT539500	hsa-miR-1226-3p	PAR-CLIP	22012620
MIRT539499	hsa-miR-4733-3p	PAR-CLIP	22012620
MIRT539498	hsa-miR-3622a-3p	PAR-CLIP	22012620
MIRT539497	hsa-miR-3622b-3p	PAR-CLIP	22012620
MIRT539496	hsa-miR-645	PAR-CLIP	22012620
MIRT539495	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT539494	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT539493	hsa-miR-4750-3p	PAR-CLIP	22012620
MIRT539492	hsa-miR-1180-5p	PAR-CLIP	22012620
MIRT539491	hsa-miR-7114-3p	PAR-CLIP	22012620
MIRT539490	hsa-miR-2115-5p	PAR-CLIP	22012620
MIRT082202	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT082173	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT082179	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT082189	hsa-miR-548ab	PAR-CLIP	23446348
MIRT082190	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT082191	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT082192	hsa-miR-548ak	PAR-CLIP	23446348
MIRT082193	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT082195	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT082197	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT082198	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT082199	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT082201	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT082203	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT082178	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT082204	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT082180	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT082181	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT082183	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT082184	hsa-miR-548i	PAR-CLIP	23446348
MIRT082182	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT082188	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT082186	hsa-miR-548w	PAR-CLIP	23446348
MIRT082187	hsa-miR-548y	PAR-CLIP	23446348
MIRT082176	hsa-miR-559	PAR-CLIP	23446348
MIRT525015	hsa-miR-548av-5p	PAR-CLIP	23446348
MIRT525014	hsa-miR-548k	PAR-CLIP	23446348
MIRT525012	hsa-miR-8054	PAR-CLIP	23446348
MIRT525013	hsa-miR-548l	PAR-CLIP	23446348
MIRT082185	hsa-miR-3121-3p	PAR-CLIP	23446348
MIRT525011	hsa-miR-605-5p	PAR-CLIP	23446348
MIRT082196	hsa-miR-5571-5p	PAR-CLIP	23446348
MIRT082174	hsa-miR-146a-3p	PAR-CLIP	23446348
MIRT525010	hsa-miR-301a-5p	PAR-CLIP	23446348
MIRT525009	hsa-miR-301b-5p	PAR-CLIP	23446348
MIRT525007	hsa-miR-3921	PAR-CLIP	23446348
MIRT525008	hsa-miR-4653-5p	PAR-CLIP	23446348
MIRT525006	hsa-miR-3191-5p	PAR-CLIP	23446348
MIRT082173	hsa-miR-142-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence, Flow cytometry	38632655
MIRT764072	hsa-miR-1224-3p	CLIP-seq
MIRT764073	hsa-miR-1237	CLIP-seq
MIRT764074	hsa-miR-124	CLIP-seq
MIRT764075	hsa-miR-1245b-5p	CLIP-seq
MIRT764076	hsa-miR-1248	CLIP-seq
MIRT764077	hsa-miR-1254	CLIP-seq
MIRT764078	hsa-miR-125a-3p	CLIP-seq
MIRT764079	hsa-miR-1288	CLIP-seq
MIRT764080	hsa-miR-1293	CLIP-seq
MIRT764081	hsa-miR-129-5p	CLIP-seq
MIRT764082	hsa-miR-1343	CLIP-seq
MIRT764083	hsa-miR-138	CLIP-seq
MIRT764084	hsa-miR-153	CLIP-seq
MIRT764085	hsa-miR-1827	CLIP-seq
MIRT764086	hsa-miR-185	CLIP-seq
MIRT764087	hsa-miR-190	CLIP-seq
MIRT764088	hsa-miR-190b	CLIP-seq
MIRT764089	hsa-miR-1915	CLIP-seq
MIRT764090	hsa-miR-193b	CLIP-seq
MIRT764091	hsa-miR-1972	CLIP-seq
MIRT764092	hsa-miR-1976	CLIP-seq
MIRT764093	hsa-miR-2052	CLIP-seq
MIRT764094	hsa-miR-2110	CLIP-seq
MIRT764095	hsa-miR-2113	CLIP-seq
MIRT764096	hsa-miR-2116	CLIP-seq
MIRT764097	hsa-miR-218	CLIP-seq
MIRT764098	hsa-miR-2278	CLIP-seq
MIRT764099	hsa-miR-2355-5p	CLIP-seq
MIRT764100	hsa-miR-2467-3p	CLIP-seq
MIRT764101	hsa-miR-2682	CLIP-seq
MIRT764102	hsa-miR-299-5p	CLIP-seq
MIRT764103	hsa-miR-31	CLIP-seq
MIRT764104	hsa-miR-3116	CLIP-seq
MIRT764105	hsa-miR-3127-5p	CLIP-seq
MIRT764106	hsa-miR-3128	CLIP-seq
MIRT764107	hsa-miR-3136-3p	CLIP-seq
MIRT764108	hsa-miR-3142	CLIP-seq
MIRT764109	hsa-miR-3147	CLIP-seq
MIRT764110	hsa-miR-3150a-3p	CLIP-seq
MIRT764111	hsa-miR-3151	CLIP-seq
MIRT764112	hsa-miR-3158-5p	CLIP-seq
MIRT764113	hsa-miR-3169	CLIP-seq
MIRT764114	hsa-miR-3174	CLIP-seq
MIRT764115	hsa-miR-3175	CLIP-seq
MIRT764116	hsa-miR-3179	CLIP-seq
MIRT764117	hsa-miR-3184	CLIP-seq
MIRT764118	hsa-miR-3189-3p	CLIP-seq
MIRT764119	hsa-miR-3199	CLIP-seq
MIRT764120	hsa-miR-3200-5p	CLIP-seq
MIRT764121	hsa-miR-3202	CLIP-seq
MIRT764122	hsa-miR-323-5p	CLIP-seq
MIRT764123	hsa-miR-330-3p	CLIP-seq
MIRT764124	hsa-miR-342-5p	CLIP-seq
MIRT764125	hsa-miR-346	CLIP-seq
MIRT764126	hsa-miR-3612	CLIP-seq
MIRT764127	hsa-miR-3613-3p	CLIP-seq
MIRT764128	hsa-miR-3622b-5p	CLIP-seq
MIRT764129	hsa-miR-3649	CLIP-seq
MIRT764130	hsa-miR-3661	CLIP-seq
MIRT764131	hsa-miR-3675-5p	CLIP-seq
MIRT764132	hsa-miR-3678-3p	CLIP-seq
MIRT764133	hsa-miR-3690	CLIP-seq
MIRT764134	hsa-miR-3691-3p	CLIP-seq
MIRT764135	hsa-miR-369-3p	CLIP-seq
MIRT764136	hsa-miR-371b-5p	CLIP-seq
MIRT764137	hsa-miR-374a	CLIP-seq
MIRT764138	hsa-miR-374b	CLIP-seq
MIRT764139	hsa-miR-3922-5p	CLIP-seq
MIRT764140	hsa-miR-3926	CLIP-seq
MIRT764141	hsa-miR-3934	CLIP-seq
MIRT764142	hsa-miR-410	CLIP-seq
MIRT764143	hsa-miR-423-5p	CLIP-seq
MIRT764144	hsa-miR-4251	CLIP-seq
MIRT764145	hsa-miR-4253	CLIP-seq
MIRT764146	hsa-miR-4254	CLIP-seq
MIRT764147	hsa-miR-4260	CLIP-seq
MIRT764148	hsa-miR-4268	CLIP-seq
MIRT764149	hsa-miR-4278	CLIP-seq
MIRT764150	hsa-miR-4283	CLIP-seq
MIRT764151	hsa-miR-4306	CLIP-seq
MIRT764152	hsa-miR-4307	CLIP-seq
MIRT764153	hsa-miR-4311	CLIP-seq
MIRT764154	hsa-miR-4316	CLIP-seq
MIRT764155	hsa-miR-4318	CLIP-seq
MIRT764156	hsa-miR-4329	CLIP-seq
MIRT764157	hsa-miR-4418	CLIP-seq
MIRT764158	hsa-miR-4421	CLIP-seq
MIRT764159	hsa-miR-4425	CLIP-seq
MIRT764160	hsa-miR-4443	CLIP-seq
MIRT764161	hsa-miR-4447	CLIP-seq
MIRT764162	hsa-miR-4455	CLIP-seq
MIRT764163	hsa-miR-4456	CLIP-seq
MIRT764164	hsa-miR-4466	CLIP-seq
MIRT764165	hsa-miR-4468	CLIP-seq
MIRT764166	hsa-miR-4472	CLIP-seq
MIRT764167	hsa-miR-4475	CLIP-seq
MIRT764168	hsa-miR-448	CLIP-seq
MIRT764169	hsa-miR-4483	CLIP-seq
MIRT764170	hsa-miR-4489	CLIP-seq
MIRT764171	hsa-miR-4492	CLIP-seq
MIRT764172	hsa-miR-4498	CLIP-seq
MIRT764173	hsa-miR-449c	CLIP-seq
MIRT764174	hsa-miR-4505	CLIP-seq
MIRT764175	hsa-miR-4508	CLIP-seq
MIRT764176	hsa-miR-4514	CLIP-seq
MIRT764177	hsa-miR-4527	CLIP-seq
MIRT764178	hsa-miR-4529-5p	CLIP-seq
MIRT764179	hsa-miR-4533	CLIP-seq
MIRT764180	hsa-miR-4635	CLIP-seq
MIRT764181	hsa-miR-4638-3p	CLIP-seq
MIRT764182	hsa-miR-4644	CLIP-seq
MIRT764183	hsa-miR-4645-5p	CLIP-seq
MIRT764184	hsa-miR-4648	CLIP-seq
MIRT764185	hsa-miR-4651	CLIP-seq
MIRT764186	hsa-miR-4654	CLIP-seq
MIRT764187	hsa-miR-4664-5p	CLIP-seq
MIRT764188	hsa-miR-4666-5p	CLIP-seq
MIRT764189	hsa-miR-4667-3p	CLIP-seq
MIRT764190	hsa-miR-4673	CLIP-seq
MIRT764191	hsa-miR-4685-5p	CLIP-seq
MIRT764192	hsa-miR-4690-3p	CLIP-seq
MIRT764193	hsa-miR-4692	CLIP-seq
MIRT764194	hsa-miR-4693-3p	CLIP-seq
MIRT764195	hsa-miR-4699-3p	CLIP-seq
MIRT764196	hsa-miR-4705	CLIP-seq
MIRT764197	hsa-miR-4708-3p	CLIP-seq
MIRT764198	hsa-miR-4710	CLIP-seq
MIRT764199	hsa-miR-4711-5p	CLIP-seq
MIRT764200	hsa-miR-4712-3p	CLIP-seq
MIRT764201	hsa-miR-4716-3p	CLIP-seq
MIRT764202	hsa-miR-4717-3p	CLIP-seq
MIRT764203	hsa-miR-4722-5p	CLIP-seq
MIRT764204	hsa-miR-4723-5p	CLIP-seq
MIRT764205	hsa-miR-4726-3p	CLIP-seq
MIRT764206	hsa-miR-4727-5p	CLIP-seq
MIRT764207	hsa-miR-4749-3p	CLIP-seq
MIRT764208	hsa-miR-4755-3p	CLIP-seq
MIRT764209	hsa-miR-4756-3p	CLIP-seq
MIRT764210	hsa-miR-4761-3p	CLIP-seq
MIRT764211	hsa-miR-4768-3p	CLIP-seq
MIRT764212	hsa-miR-4769-3p	CLIP-seq
MIRT764213	hsa-miR-4769-5p	CLIP-seq
MIRT764214	hsa-miR-4781-3p	CLIP-seq
MIRT764215	hsa-miR-4781-5p	CLIP-seq
MIRT764216	hsa-miR-4787-5p	CLIP-seq
MIRT764217	hsa-miR-4792	CLIP-seq
MIRT764218	hsa-miR-4795-3p	CLIP-seq
MIRT764219	hsa-miR-4797-5p	CLIP-seq
MIRT764220	hsa-miR-485-3p	CLIP-seq
MIRT764221	hsa-miR-487a	CLIP-seq
MIRT764222	hsa-miR-490-3p	CLIP-seq
MIRT764223	hsa-miR-491-5p	CLIP-seq
MIRT764224	hsa-miR-506	CLIP-seq
MIRT764225	hsa-miR-509-3-5p	CLIP-seq
MIRT764226	hsa-miR-509-5p	CLIP-seq
MIRT764227	hsa-miR-512-5p	CLIP-seq
MIRT764228	hsa-miR-516b	CLIP-seq
MIRT764229	hsa-miR-518e	CLIP-seq
MIRT764230	hsa-miR-520f	CLIP-seq
MIRT764231	hsa-miR-541	CLIP-seq
MIRT764232	hsa-miR-545	CLIP-seq
MIRT764233	hsa-miR-548aa	CLIP-seq
MIRT764234	hsa-miR-548c-3p	CLIP-seq
MIRT764235	hsa-miR-548h	CLIP-seq
MIRT764236	hsa-miR-548j	CLIP-seq
MIRT764237	hsa-miR-548m	CLIP-seq
MIRT764238	hsa-miR-548p	CLIP-seq
MIRT764239	hsa-miR-548s	CLIP-seq
MIRT764240	hsa-miR-561	CLIP-seq
MIRT764241	hsa-miR-566	CLIP-seq
MIRT764242	hsa-miR-599	CLIP-seq
MIRT764243	hsa-miR-605	CLIP-seq
MIRT764244	hsa-miR-608	CLIP-seq
MIRT764245	hsa-miR-609	CLIP-seq
MIRT764246	hsa-miR-625	CLIP-seq
MIRT764247	hsa-miR-627	CLIP-seq
MIRT764248	hsa-miR-631	CLIP-seq
MIRT764249	hsa-miR-636	CLIP-seq
MIRT764250	hsa-miR-650	CLIP-seq
MIRT764251	hsa-miR-654-5p	CLIP-seq
MIRT764252	hsa-miR-659	CLIP-seq
MIRT764253	hsa-miR-675	CLIP-seq
MIRT764254	hsa-miR-758	CLIP-seq
MIRT764255	hsa-miR-759	CLIP-seq
MIRT764256	hsa-miR-762	CLIP-seq
MIRT764257	hsa-miR-764	CLIP-seq
MIRT764258	hsa-miR-765	CLIP-seq
MIRT764259	hsa-miR-876-3p	CLIP-seq
MIRT764260	hsa-miR-888	CLIP-seq
MIRT764261	hsa-miR-924	CLIP-seq
MIRT764262	hsa-miR-939	CLIP-seq
MIRT764085	hsa-miR-1827	CLIP-seq
MIRT764086	hsa-miR-185	CLIP-seq
MIRT764087	hsa-miR-190	CLIP-seq
MIRT764088	hsa-miR-190b	CLIP-seq
MIRT764089	hsa-miR-1915	CLIP-seq
MIRT764098	hsa-miR-2278	CLIP-seq
MIRT764121	hsa-miR-3202	CLIP-seq
MIRT764128	hsa-miR-3622b-5p	CLIP-seq
MIRT764145	hsa-miR-4253	CLIP-seq
MIRT764151	hsa-miR-4306	CLIP-seq
MIRT764179	hsa-miR-4533	CLIP-seq
MIRT764182	hsa-miR-4644	CLIP-seq
MIRT764191	hsa-miR-4685-5p	CLIP-seq
MIRT764200	hsa-miR-4712-3p	CLIP-seq
MIRT764203	hsa-miR-4722-5p	CLIP-seq
MIRT764205	hsa-miR-4726-3p	CLIP-seq
MIRT764209	hsa-miR-4756-3p	CLIP-seq
MIRT764210	hsa-miR-4761-3p	CLIP-seq
MIRT764211	hsa-miR-4768-3p	CLIP-seq
MIRT764214	hsa-miR-4781-3p	CLIP-seq
MIRT764072	hsa-miR-1224-3p	CLIP-seq
MIRT764080	hsa-miR-1293	CLIP-seq
MIRT764083	hsa-miR-138	CLIP-seq
MIRT764085	hsa-miR-1827	CLIP-seq
MIRT764089	hsa-miR-1915	CLIP-seq
MIRT764091	hsa-miR-1972	CLIP-seq
MIRT764096	hsa-miR-2116	CLIP-seq
MIRT764097	hsa-miR-218	CLIP-seq
MIRT764099	hsa-miR-2355-5p	CLIP-seq
MIRT764105	hsa-miR-3127-5p	CLIP-seq
MIRT764120	hsa-miR-3200-5p	CLIP-seq
MIRT764121	hsa-miR-3202	CLIP-seq
MIRT764123	hsa-miR-330-3p	CLIP-seq
MIRT764124	hsa-miR-342-5p	CLIP-seq
MIRT764125	hsa-miR-346	CLIP-seq
MIRT764128	hsa-miR-3622b-5p	CLIP-seq
MIRT764133	hsa-miR-3690	CLIP-seq
MIRT764139	hsa-miR-3922-5p	CLIP-seq
MIRT764144	hsa-miR-4251	CLIP-seq
MIRT764145	hsa-miR-4253	CLIP-seq
MIRT764148	hsa-miR-4268	CLIP-seq
MIRT764149	hsa-miR-4278	CLIP-seq
MIRT764154	hsa-miR-4316	CLIP-seq
MIRT764156	hsa-miR-4329	CLIP-seq
MIRT764163	hsa-miR-4456	CLIP-seq
MIRT764164	hsa-miR-4466	CLIP-seq
MIRT764167	hsa-miR-4475	CLIP-seq
MIRT764169	hsa-miR-4483	CLIP-seq
MIRT764171	hsa-miR-4492	CLIP-seq
MIRT764172	hsa-miR-4498	CLIP-seq
MIRT764175	hsa-miR-4508	CLIP-seq
MIRT764176	hsa-miR-4514	CLIP-seq
MIRT764177	hsa-miR-4527	CLIP-seq
MIRT764178	hsa-miR-4529-5p	CLIP-seq
MIRT764179	hsa-miR-4533	CLIP-seq
MIRT764183	hsa-miR-4645-5p	CLIP-seq
MIRT764184	hsa-miR-4648	CLIP-seq
MIRT764185	hsa-miR-4651	CLIP-seq
MIRT764186	hsa-miR-4654	CLIP-seq
MIRT764187	hsa-miR-4664-5p	CLIP-seq
MIRT764190	hsa-miR-4673	CLIP-seq
MIRT764191	hsa-miR-4685-5p	CLIP-seq
MIRT764192	hsa-miR-4690-3p	CLIP-seq
MIRT764193	hsa-miR-4692	CLIP-seq
MIRT764197	hsa-miR-4708-3p	CLIP-seq
MIRT764198	hsa-miR-4710	CLIP-seq
MIRT764201	hsa-miR-4716-3p	CLIP-seq
MIRT764205	hsa-miR-4726-3p	CLIP-seq
MIRT764206	hsa-miR-4727-5p	CLIP-seq
MIRT764208	hsa-miR-4755-3p	CLIP-seq
MIRT764210	hsa-miR-4761-3p	CLIP-seq
MIRT764212	hsa-miR-4769-3p	CLIP-seq
MIRT764213	hsa-miR-4769-5p	CLIP-seq
MIRT764215	hsa-miR-4781-5p	CLIP-seq
MIRT764217	hsa-miR-4792	CLIP-seq
MIRT764220	hsa-miR-485-3p	CLIP-seq
MIRT764221	hsa-miR-487a	CLIP-seq
MIRT764227	hsa-miR-512-5p	CLIP-seq
MIRT764228	hsa-miR-516b	CLIP-seq
MIRT764231	hsa-miR-541	CLIP-seq
MIRT764233	hsa-miR-548aa	CLIP-seq
MIRT764237	hsa-miR-548m	CLIP-seq
MIRT764238	hsa-miR-548p	CLIP-seq
MIRT764244	hsa-miR-608	CLIP-seq
MIRT764251	hsa-miR-654-5p	CLIP-seq
MIRT764252	hsa-miR-659	CLIP-seq
MIRT764253	hsa-miR-675	CLIP-seq
MIRT764256	hsa-miR-762	CLIP-seq
MIRT764259	hsa-miR-876-3p	CLIP-seq
MIRT764262	hsa-miR-939	CLIP-seq
MIRT764074	hsa-miR-124	CLIP-seq
MIRT764077	hsa-miR-1254	CLIP-seq
MIRT764078	hsa-miR-125a-3p	CLIP-seq
MIRT764080	hsa-miR-1293	CLIP-seq
MIRT764082	hsa-miR-1343	CLIP-seq
MIRT764083	hsa-miR-138	CLIP-seq
MIRT764086	hsa-miR-185	CLIP-seq
MIRT764087	hsa-miR-190	CLIP-seq
MIRT764088	hsa-miR-190b	CLIP-seq
MIRT764091	hsa-miR-1972	CLIP-seq
MIRT764097	hsa-miR-218	CLIP-seq
MIRT764098	hsa-miR-2278	CLIP-seq
MIRT764099	hsa-miR-2355-5p	CLIP-seq
MIRT764101	hsa-miR-2682	CLIP-seq
MIRT764102	hsa-miR-299-5p	CLIP-seq
MIRT764104	hsa-miR-3116	CLIP-seq
MIRT764105	hsa-miR-3127-5p	CLIP-seq
MIRT764107	hsa-miR-3136-3p	CLIP-seq
MIRT764115	hsa-miR-3175	CLIP-seq
MIRT764117	hsa-miR-3184	CLIP-seq
MIRT764121	hsa-miR-3202	CLIP-seq
MIRT764122	hsa-miR-323-5p	CLIP-seq
MIRT764123	hsa-miR-330-3p	CLIP-seq
MIRT764124	hsa-miR-342-5p	CLIP-seq
MIRT764125	hsa-miR-346	CLIP-seq
MIRT764128	hsa-miR-3622b-5p	CLIP-seq
MIRT764131	hsa-miR-3675-5p	CLIP-seq
MIRT764133	hsa-miR-3690	CLIP-seq
MIRT764139	hsa-miR-3922-5p	CLIP-seq
MIRT764141	hsa-miR-3934	CLIP-seq
MIRT764143	hsa-miR-423-5p	CLIP-seq
MIRT764145	hsa-miR-4253	CLIP-seq
MIRT764146	hsa-miR-4254	CLIP-seq
MIRT764148	hsa-miR-4268	CLIP-seq
MIRT764149	hsa-miR-4278	CLIP-seq
MIRT764150	hsa-miR-4283	CLIP-seq
MIRT764151	hsa-miR-4306	CLIP-seq
MIRT764154	hsa-miR-4316	CLIP-seq
MIRT764158	hsa-miR-4421	CLIP-seq
MIRT764163	hsa-miR-4456	CLIP-seq
MIRT764164	hsa-miR-4466	CLIP-seq
MIRT764167	hsa-miR-4475	CLIP-seq
MIRT764169	hsa-miR-4483	CLIP-seq
MIRT764170	hsa-miR-4489	CLIP-seq
MIRT764171	hsa-miR-4492	CLIP-seq
MIRT764172	hsa-miR-4498	CLIP-seq
MIRT764173	hsa-miR-449c	CLIP-seq
MIRT764174	hsa-miR-4505	CLIP-seq
MIRT764175	hsa-miR-4508	CLIP-seq
MIRT764176	hsa-miR-4514	CLIP-seq
MIRT764177	hsa-miR-4527	CLIP-seq
MIRT764178	hsa-miR-4529-5p	CLIP-seq
MIRT764179	hsa-miR-4533	CLIP-seq
MIRT764181	hsa-miR-4638-3p	CLIP-seq
MIRT764182	hsa-miR-4644	CLIP-seq
MIRT764183	hsa-miR-4645-5p	CLIP-seq
MIRT764185	hsa-miR-4651	CLIP-seq
MIRT764186	hsa-miR-4654	CLIP-seq
MIRT764187	hsa-miR-4664-5p	CLIP-seq
MIRT764190	hsa-miR-4673	CLIP-seq
MIRT764192	hsa-miR-4690-3p	CLIP-seq
MIRT764193	hsa-miR-4692	CLIP-seq
MIRT764197	hsa-miR-4708-3p	CLIP-seq
MIRT764199	hsa-miR-4711-5p	CLIP-seq
MIRT764200	hsa-miR-4712-3p	CLIP-seq
MIRT764201	hsa-miR-4716-3p	CLIP-seq
MIRT764202	hsa-miR-4717-3p	CLIP-seq
MIRT764203	hsa-miR-4722-5p	CLIP-seq
MIRT764204	hsa-miR-4723-5p	CLIP-seq
MIRT764206	hsa-miR-4727-5p	CLIP-seq
MIRT764208	hsa-miR-4755-3p	CLIP-seq
MIRT764209	hsa-miR-4756-3p	CLIP-seq
MIRT764210	hsa-miR-4761-3p	CLIP-seq
MIRT764211	hsa-miR-4768-3p	CLIP-seq
MIRT764212	hsa-miR-4769-3p	CLIP-seq
MIRT764213	hsa-miR-4769-5p	CLIP-seq
MIRT764214	hsa-miR-4781-3p	CLIP-seq
MIRT764215	hsa-miR-4781-5p	CLIP-seq
MIRT764218	hsa-miR-4795-3p	CLIP-seq
MIRT764219	hsa-miR-4797-5p	CLIP-seq
MIRT764224	hsa-miR-506	CLIP-seq
MIRT764227	hsa-miR-512-5p	CLIP-seq
MIRT764231	hsa-miR-541	CLIP-seq
MIRT764232	hsa-miR-545	CLIP-seq
MIRT764233	hsa-miR-548aa	CLIP-seq
MIRT764237	hsa-miR-548m	CLIP-seq
MIRT764238	hsa-miR-548p	CLIP-seq
MIRT764241	hsa-miR-566	CLIP-seq
MIRT764244	hsa-miR-608	CLIP-seq
MIRT764251	hsa-miR-654-5p	CLIP-seq
MIRT764253	hsa-miR-675	CLIP-seq
MIRT764255	hsa-miR-759	CLIP-seq
MIRT764256	hsa-miR-762	CLIP-seq
MIRT764257	hsa-miR-764	CLIP-seq
MIRT764258	hsa-miR-765	CLIP-seq
MIRT764259	hsa-miR-876-3p	CLIP-seq
MIRT764262	hsa-miR-939	CLIP-seq
MIRT764081	hsa-miR-129-5p	CLIP-seq
MIRT764091	hsa-miR-1972	CLIP-seq
MIRT764092	hsa-miR-1976	CLIP-seq
MIRT764099	hsa-miR-2355-5p	CLIP-seq
MIRT764103	hsa-miR-31	CLIP-seq
MIRT764106	hsa-miR-3128	CLIP-seq
MIRT764114	hsa-miR-3174	CLIP-seq
MIRT764154	hsa-miR-4316	CLIP-seq
MIRT764176	hsa-miR-4514	CLIP-seq
MIRT764178	hsa-miR-4529-5p	CLIP-seq
MIRT764183	hsa-miR-4645-5p	CLIP-seq
MIRT764190	hsa-miR-4673	CLIP-seq
MIRT764193	hsa-miR-4692	CLIP-seq
MIRT764208	hsa-miR-4755-3p	CLIP-seq
MIRT764233	hsa-miR-548aa	CLIP-seq
MIRT764247	hsa-miR-627	CLIP-seq
MIRT764252	hsa-miR-659	CLIP-seq
MIRT764259	hsa-miR-876-3p	CLIP-seq
MIRT764261	hsa-miR-924	CLIP-seq
MIRT764195	hsa-miR-4699-3p	CLIP-seq
MIRT764220	hsa-miR-485-3p	CLIP-seq
MIRT764221	hsa-miR-487a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC7	Repression	16980305

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	25411248
GO:0001725	Component	Stress fiber	IEA
GO:0001882	Function	Nucleoside binding	IDA	12411747
GO:0003713	Function	Transcription coactivator activity	IMP	22351778, 25411248
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	TAS	8104223
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	TAS	8104223
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10753915, 15619032, 15841212, 15988023, 16189514, 16204054, 16944923, 19447967, 22351778, 22662192, 24802111, 25241761, 25411248, 25416956, 25910212, 26496610, 26871637, 28514442, 29892012, 32296183, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	IDA	9508771, 22351778, 25411248
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	HDA	16791210
GO:0005737	Component	Cytoplasm	IDA	9508771, 22351778, 25411248
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0015031	Process	Protein transport	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	25918384
GO:0015629	Component	Actin cytoskeleton	IDA	15048094
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	22351778
GO:0030018	Component	Z disc	IBA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030050	Process	Vesicle transport along actin filament	IMP	25918384
GO:0030054	Component	Cell junction	IBA
GO:0030054	Component	Cell junction	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	25918384
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031143	Component	Pseudopodium	IEA
GO:0031143	Component	Pseudopodium	TAS	1629252
GO:0031490	Function	Chromatin DNA binding	IDA	25411248
GO:0032417	Process	Positive regulation of sodium:proton antiporter activity	NAS	11948184
GO:0032991	Component	Protein-containing complex	IDA	11948184
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	25411248
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IDA	22351778
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	22351778
GO:0042974	Function	Nuclear retinoic acid receptor binding	IPI	22351778
GO:0042981	Process	Regulation of apoptotic process	NAS	16807302
GO:0042995	Component	Cell projection	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	19943616
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22351778
GO:0046872	Function	Metal ion binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	22351778
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15619032
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	12411747
GO:0051015	Function	Actin filament binding	IMP	25918384
GO:0055001	Process	Muscle cell development	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 21362503, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0098871	Component	Postsynaptic actin cytoskeleton	IDA	30123108
GO:0098871	Component	Postsynaptic actin cytoskeleton	IMP	30123108
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IMP	25918384
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	25411248
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

Other IDs

• MIM: 604638
• HGNC: 166
• e!Ensembl: ENSG00000130402

Protein

• UniProt ID: O43707
• Protein name: Alpha-actinin-4 (Non-muscle alpha-actinin 4)
• Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein (Probable). Probably involved in vesicular trafficking via its association with the CART complex. The CART comple
• PDB: 1WLX, 1YDI, 2R0O, 6O31, 6OA6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00307	CH	50 → 155	Calponin homology (CH) domain	Domain
  PF00307	CH	163 → 270	Calponin homology (CH) domain	Domain
  PF00435	Spectrin	293 → 403	Spectrin repeat	Domain
  PF00435	Spectrin	413 → 518	Spectrin repeat	Domain
  PF00435	Spectrin	528 → 639	Spectrin repeat	Domain
  PF00435	Spectrin	649 → 752	Spectrin repeat	Domain
  PF08726	EFhand_Ca_insen	841 → 907	Ca2+ insensitive EF hand	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9508771}.
• Sequence:

  MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
  NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
  SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
  KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
  LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
  LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
  QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
  KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
  NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
  NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
  NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
  VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
  DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
  HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
  DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
  FSTALYGESDL

• Sequence length: 911

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ACTN4-related disorder	Likely pathogenic	rs2515210564, rs2515200704	RCV003909778 RCV003983643	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Focal segmental glomerulosclerosis 1	Likely pathogenic; Pathogenic	rs1968240092, rs121908415, rs121908416, rs121908417, rs878853159, rs2515200645, rs2515200807, rs2515217834, rs1568723797, rs1568725026	RCV001329330 RCV000005753 RCV000005754 RCV000005755 RCV000224984 RCV003225636 RCV003314314 RCV003992067 RCV004555718 RCV000735729 RCV000735654	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic kidney disease	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corticosteroids response	drug response; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL IDIOPATHIC STEROID-RESISTANT NEPHROTIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC STEROID-RESISTANT NEPHROTIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY STEROID-RESISTANT NEPHROTIC SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PREGNANCY-INDUCED	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability, autosomal dominant 14	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEPHROTIC SYNDROME WITH FOCAL AND SEGMENTAL HYALINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME WITH FOCAL AND SEGMENTAL SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME WITH FOCAL GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME, FOCAL AND SEGMENTAL GLOMERULAR LESIONS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23618379		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23899839		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23899839, 28658966		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	22348389		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	27613243	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20156433		★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	30123108		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	30123108		★☆☆☆☆ Found in Text Mining only
Atrophy of kidney	Atrophy Of Kidney	BEFREE	27733133		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30123108		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19969329, 23817592		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25885339	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23810014, 29055790, 29197410, 31054253, 9508771		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17052974, 17873890, 21078666, 30258071, 32265507, 9508771	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31054253	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	27155012	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17151021	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	24574362, 31054253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of bladder	Bladder carcinoma	BEFREE	19969329, 23817592		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11358829, 15048094, 22887464, 25299231, 25885339, 29251177		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31967944	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27613525	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18362906, 19151661		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	18765526		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	LHGDN	18765526		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Cerebellar hemangioblastoma	Cerebellar hemangioblastoma	BEFREE	23618379		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27065319, 29867145, 31584624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	27065319, 29867145, 31584624		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34509526	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18436095, 22965004, 27733133, 27977723, 9434071		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	9434071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	18348187		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16204054, 25860875		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17873890, 25860875	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22348389		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20063376		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17968527, 26480949		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18552466, 22629296, 27613243, 28990106	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17968527, 25107948, 26480949, 28663230, 29720549		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17968527, 18552466		★☆☆☆☆ Found in Text Mining only
Diffuse mesangial sclerosis (disorder)	Mesangial sclerosis	BEFREE	26015453, 28566477		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27784647		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19055724	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22348389		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17960614	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17960614	Associate	★☆☆☆☆ Found in Text Mining only
Familial hematuria	Hematuria	BEFREE	29138824		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	12617336, 12704574, 12707390, 12776268, 14569107, 15208719, 15627790, 16251236, 17530296, 18164029, 18436095, 19142020, 19666657, 21680739, 22351778, 22971997, 23014460, 23686279, 23689571, 23890478, 24500309, 24940801, 25107948, 26740551, 27977723, 27998979, 28720684, 29378953, 29873512, 31269922, 31664084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	16251236, 18164029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis 1	Focal segmental glomerulosclerosis	UNIPROT_DG	10700177, 18164029, 18436095, 22351778, 22732337, 23014460, 23890478		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Focal segmental glomerulosclerosis 1	Focal segmental glomerulosclerosis	GENOMICS_ENGLAND_DG	10700177, 16251236, 29043128		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Focal segmental glomerulosclerosis 1	Focal segmental glomerulosclerosis	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	12617336, 12707390, 15208719, 19142020, 19666657, 25107948, 26740551, 28720684		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17668415		★☆☆☆☆ Found in Text Mining only
Galloway Mowat syndrome	Galloway-Mowat Syndrome	BEFREE	18594871		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32736695	Associate	★☆☆☆☆ Found in Text Mining only
Genetic steroid-resistant nephrotic syndrome	Genetic Steroid-Resistant Nephrotic Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	23504125, 31492748		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23504125, 31492748		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31492748		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	30696480		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	23890478	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	10198566, 18185509		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	12617336, 15780077, 18164029, 22351778, 22965004, 27977723, 27998979, 29138824, 31930129	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	29138824	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28928136		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	28928136		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 1, Intestinal	Intestinal Hypomagnesemia	BEFREE	20395377		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23890478		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24630158, 27432742, 28663230		★☆☆☆☆ Found in Text Mining only
Immune Complex Diseases	Immune Complex Diseases	BEFREE	28442280		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	18765526		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10966492, 18164029, 20395377, 22351778, 24676636, 24903390, 26015453, 26668025, 27998979, 28245472, 29968413, 30099615, 30709661, 31308072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	18164029, 18552466, 19357256, 19652713, 25918384, 27998979, 31930129	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	18434567, 19838113, 20395377, 24676636, 26015453, 27733133		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22965004	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	18436095, 22965004, 27733133, 27977723, 9434071		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	33454316	Associate	★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	23890478, 24722446, 25635037, 30143559, 30642877, 31269922		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25759210, 31509262, 31533816, 31666112		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17873890, 25299231, 25885339, 29251177	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30696480		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31630440		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17960614	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32801264, 32855746, 37226638	Associate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	22578956, 23890478, 27940460		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23810014, 29055790, 29197410, 31054253, 9508771		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27784647		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22887464, 25299231, 25885339, 29251177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18362906, 19151661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18765526, 25602965, 29921500, 30353690, 31358530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28581489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	28385383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19969329, 23817592		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19913389, 19969329, 23000411, 23504125, 23817592, 24574362, 25299231, 25860875, 27065319, 27121206, 28579451, 29143101, 29197410, 29706658, 29921500, 31399951, 31584624, 9508771		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27065319, 29867145, 31584624		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25296750, 29274473, 29706658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	25296750, 29274473	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	24722446, 25107948, 29915132, 29968413, 30709661		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	18552466	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35568845	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10656685, 15048094, 16077989, 19151661, 20819441, 22348389, 23504125, 23817592, 27065319, 28216224, 28748856, 31054253, 31766144		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31086291		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21775482, 23618379		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	24876116, 30647093		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 3	Nephronophthisis	Pubtator	31922211	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	14569107		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	23890478	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	36293475	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10966492, 12761234, 16186681, 18434567, 18436095, 19142020, 20616172, 24260533, 25145932, 30973669		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16050398, 21415313, 23890478, 31930129, 35920919, 37014572	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	23890478, 25903641, 28336816		★☆☆☆☆ Found in Text Mining only
NEPHROTIC SYNDROME, STEROID-RESISTANT, AUTOSOMAL RECESSIVE	Nephritis	ORPHANET_DG	10700177		★☆☆☆☆ Found in Text Mining only
NEPHROTIC SYNDROME, STEROID-RESISTANT, AUTOSOMAL RECESSIVE	Nephritis	BEFREE	10966492		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10656685		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22887464		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19913389, 25299231, 27121206		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26147062	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30879239		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18362906		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18362906, 19151661		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17873890, 18362906, 19151661, 25265318	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18765526, 25602965, 29921500, 31358530		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19373808, 25602965, 26850699	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18362906	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23618379		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17052974, 31941606	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17151021	Inhibit	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	18552466, 27998979	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36974749	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30737270		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	12397035, 18185509, 21680739, 23990165, 25967120, 31169337		★☆☆☆☆ Found in Text Mining only
Salcedo syndrome	Nail patella-like renal disease	BEFREE	23687361		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	24574362	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28114394		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	18765526		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15122314, 25750325		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12093915, 36476259	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19913389, 28779483		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28533408, 30542119		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32801264	Associate	★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	12776268, 19956976, 20191367, 25967120, 30910934, 31040189		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28581489		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28581489	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	28385383	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	37226638	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19373808, 31889512	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25215525, 32855746, 34998421	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36974749	Associate	★☆☆☆☆ Found in Text Mining only