ACRV1 (acrosomal vesicle protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 56
Gene name Acrosomal vesicle protein 1
Gene symbol ACRV1
Synonyms (NCBI Gene)
D11S4365SP-10SPACA2
Chromosome 11
Chromosome location 11q24.2
Summary This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle pr
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2468859 hsa-miR-1253 CLIP-seq
MIRT2468860 hsa-miR-1261 CLIP-seq
MIRT2468861 hsa-miR-3919 CLIP-seq
MIRT2468862 hsa-miR-4422 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Download as csvDownload as pdf
Transcription factor Regulation Reference
ILF2 Activation 17942973
ILF3 Activation 17942973
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IBA
GO:0007283 Process Spermatogenesis NAS 21252238
GO:0031410 Component Cytoplasmic vesicle IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
102525 127 ENSG00000134940
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26436
Protein name Acrosomal protein SP-10 (Acrosomal vesicle protein 1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis.
Sequence 
MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSS
GLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPS
GEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPIS
STSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCP
SMNLFSHGTRMQIICCRNQSFCNKI
Sequence length 265
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Prostate cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 19931263 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Severe Acute Respiratory Syndrome Severe Acute Respiratory Syndrome BEFREE 16337697
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for ACRV1.

No additional diseases found yet through genes similar to ACRV1.