Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	32
Gene name	Acetyl-CoA carboxylase beta
Gene symbol	ACACB
Synonyms (NCBI Gene)	ACACbetaACC-betaACC2ACCBACCbetaHACC275
Chromosome	12
Chromosome location	12q24.11
Summary	Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatt

374

Show/Hide all (374)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019364	hsa-miR-148b-3p	Microarray	17612493
MIRT630853	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT630852	hsa-miR-596	HITS-CLIP	23824327
MIRT630850	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT630849	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT630848	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT630847	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT630846	hsa-miR-6076	HITS-CLIP	23824327
MIRT630845	hsa-miR-6797-3p	HITS-CLIP	23824327
MIRT630844	hsa-miR-4252	HITS-CLIP	23824327
MIRT630843	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT630842	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT630841	hsa-miR-7703	HITS-CLIP	23824327
MIRT630853	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT630852	hsa-miR-596	HITS-CLIP	23824327
MIRT630851	hsa-miR-425-5p	HITS-CLIP	23824327
MIRT630850	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT630849	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT630848	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT630847	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT630846	hsa-miR-6076	HITS-CLIP	23824327
MIRT630845	hsa-miR-6797-3p	HITS-CLIP	23824327
MIRT630844	hsa-miR-4252	HITS-CLIP	23824327
MIRT630843	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT630842	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT630841	hsa-miR-7703	HITS-CLIP	23824327
MIRT441298	hsa-miR-544a	HITS-CLIP	24374217
MIRT441298	hsa-miR-544a	HITS-CLIP	24374217
MIRT630853	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT630852	hsa-miR-596	HITS-CLIP	23824327
MIRT630850	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT630849	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT630848	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT630847	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT630846	hsa-miR-6076	HITS-CLIP	23824327
MIRT630845	hsa-miR-6797-3p	HITS-CLIP	23824327
MIRT630844	hsa-miR-4252	HITS-CLIP	23824327
MIRT630843	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT630842	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT630841	hsa-miR-7703	HITS-CLIP	23824327
MIRT630853	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT630852	hsa-miR-596	HITS-CLIP	23824327
MIRT630851	hsa-miR-425-5p	HITS-CLIP	23824327
MIRT630850	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT630849	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT630848	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT630847	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT630846	hsa-miR-6076	HITS-CLIP	23824327
MIRT630845	hsa-miR-6797-3p	HITS-CLIP	23824327
MIRT630844	hsa-miR-4252	HITS-CLIP	23824327
MIRT630843	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT630842	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT630841	hsa-miR-7703	HITS-CLIP	23824327
MIRT761311	hsa-miR-103a	CLIP-seq
MIRT761312	hsa-miR-107	CLIP-seq
MIRT761313	hsa-miR-1280	CLIP-seq
MIRT761314	hsa-miR-1285	CLIP-seq
MIRT761315	hsa-miR-1290	CLIP-seq
MIRT761316	hsa-miR-1293	CLIP-seq
MIRT761317	hsa-miR-15a	CLIP-seq
MIRT761318	hsa-miR-15b	CLIP-seq
MIRT761319	hsa-miR-16	CLIP-seq
MIRT761320	hsa-miR-181a	CLIP-seq
MIRT761321	hsa-miR-181b	CLIP-seq
MIRT761322	hsa-miR-181c	CLIP-seq
MIRT761323	hsa-miR-181d	CLIP-seq
MIRT761324	hsa-miR-1913	CLIP-seq
MIRT761325	hsa-miR-195	CLIP-seq
MIRT761326	hsa-miR-204	CLIP-seq
MIRT761327	hsa-miR-2053	CLIP-seq
MIRT761328	hsa-miR-208a	CLIP-seq
MIRT761329	hsa-miR-208b	CLIP-seq
MIRT761330	hsa-miR-211	CLIP-seq
MIRT761331	hsa-miR-2115	CLIP-seq
MIRT761332	hsa-miR-24	CLIP-seq
MIRT761333	hsa-miR-298	CLIP-seq
MIRT761334	hsa-miR-31	CLIP-seq
MIRT761335	hsa-miR-3122	CLIP-seq
MIRT761336	hsa-miR-3136-3p	CLIP-seq
MIRT761337	hsa-miR-3140-3p	CLIP-seq
MIRT761338	hsa-miR-3158-5p	CLIP-seq
MIRT761339	hsa-miR-3173-5p	CLIP-seq
MIRT761340	hsa-miR-3187-5p	CLIP-seq
MIRT761341	hsa-miR-3188	CLIP-seq
MIRT761342	hsa-miR-3189-3p	CLIP-seq
MIRT761343	hsa-miR-324-3p	CLIP-seq
MIRT761344	hsa-miR-325	CLIP-seq
MIRT761345	hsa-miR-328	CLIP-seq
MIRT761346	hsa-miR-330-3p	CLIP-seq
MIRT761347	hsa-miR-335	CLIP-seq
MIRT761348	hsa-miR-3612	CLIP-seq
MIRT761349	hsa-miR-362-5p	CLIP-seq
MIRT761350	hsa-miR-3685	CLIP-seq
MIRT761351	hsa-miR-3689a-3p	CLIP-seq
MIRT761352	hsa-miR-3689c	CLIP-seq
MIRT761353	hsa-miR-3692	CLIP-seq
MIRT761354	hsa-miR-371b-3p	CLIP-seq
MIRT761355	hsa-miR-384	CLIP-seq
MIRT761356	hsa-miR-3913-5p	CLIP-seq
MIRT761357	hsa-miR-424	CLIP-seq
MIRT761358	hsa-miR-425	CLIP-seq
MIRT761359	hsa-miR-4262	CLIP-seq
MIRT761360	hsa-miR-4277	CLIP-seq
MIRT761361	hsa-miR-4284	CLIP-seq
MIRT761362	hsa-miR-4291	CLIP-seq
MIRT761363	hsa-miR-4292	CLIP-seq
MIRT761364	hsa-miR-4308	CLIP-seq
MIRT761365	hsa-miR-4310	CLIP-seq
MIRT761366	hsa-miR-4426	CLIP-seq
MIRT761367	hsa-miR-4443	CLIP-seq
MIRT761368	hsa-miR-4446-5p	CLIP-seq
MIRT761369	hsa-miR-4483	CLIP-seq
MIRT761370	hsa-miR-4520a-3p	CLIP-seq
MIRT761371	hsa-miR-4520b-3p	CLIP-seq
MIRT761372	hsa-miR-4524	CLIP-seq
MIRT761373	hsa-miR-4530	CLIP-seq
MIRT761374	hsa-miR-4645-5p	CLIP-seq
MIRT761375	hsa-miR-4647	CLIP-seq
MIRT761376	hsa-miR-4662b	CLIP-seq
MIRT761377	hsa-miR-4673	CLIP-seq
MIRT761378	hsa-miR-4685-5p	CLIP-seq
MIRT761379	hsa-miR-4728-5p	CLIP-seq
MIRT761380	hsa-miR-4729	CLIP-seq
MIRT761381	hsa-miR-4755-5p	CLIP-seq
MIRT761382	hsa-miR-4761-5p	CLIP-seq
MIRT761383	hsa-miR-4768-5p	CLIP-seq
MIRT761384	hsa-miR-4779	CLIP-seq
MIRT761385	hsa-miR-4780	CLIP-seq
MIRT761386	hsa-miR-483-5p	CLIP-seq
MIRT761387	hsa-miR-497	CLIP-seq
MIRT761388	hsa-miR-499-5p	CLIP-seq
MIRT761389	hsa-miR-500b	CLIP-seq
MIRT761390	hsa-miR-503	CLIP-seq
MIRT761391	hsa-miR-511	CLIP-seq
MIRT761392	hsa-miR-515-5p	CLIP-seq
MIRT761393	hsa-miR-545	CLIP-seq
MIRT761394	hsa-miR-548aa	CLIP-seq
MIRT761395	hsa-miR-612	CLIP-seq
MIRT761396	hsa-miR-623	CLIP-seq
MIRT761397	hsa-miR-634	CLIP-seq
MIRT761398	hsa-miR-635	CLIP-seq
MIRT761399	hsa-miR-642b	CLIP-seq
MIRT761400	hsa-miR-646	CLIP-seq
MIRT761401	hsa-miR-650	CLIP-seq
MIRT761402	hsa-miR-670	CLIP-seq
MIRT761403	hsa-miR-7	CLIP-seq
MIRT761404	hsa-miR-766	CLIP-seq
MIRT1924491	hsa-miR-1253	CLIP-seq
MIRT1924492	hsa-miR-1270	CLIP-seq
MIRT1924493	hsa-miR-1305	CLIP-seq
MIRT1924494	hsa-miR-1343	CLIP-seq
MIRT1924495	hsa-miR-185	CLIP-seq
MIRT761327	hsa-miR-2053	CLIP-seq
MIRT761328	hsa-miR-208a	CLIP-seq
MIRT761329	hsa-miR-208b	CLIP-seq
MIRT1924496	hsa-miR-2861	CLIP-seq
MIRT761338	hsa-miR-3158-5p	CLIP-seq
MIRT761342	hsa-miR-3189-3p	CLIP-seq
MIRT1924497	hsa-miR-3613-3p	CLIP-seq
MIRT1924498	hsa-miR-371-5p	CLIP-seq
MIRT1924499	hsa-miR-371b-5p	CLIP-seq
MIRT1924500	hsa-miR-4306	CLIP-seq
MIRT1924501	hsa-miR-432	CLIP-seq
MIRT761368	hsa-miR-4446-5p	CLIP-seq
MIRT1924502	hsa-miR-4531	CLIP-seq
MIRT1924503	hsa-miR-4644	CLIP-seq
MIRT761381	hsa-miR-4755-5p	CLIP-seq
MIRT761386	hsa-miR-483-5p	CLIP-seq
MIRT761388	hsa-miR-499-5p	CLIP-seq
MIRT1924504	hsa-miR-502-5p	CLIP-seq
MIRT1924505	hsa-miR-541	CLIP-seq
MIRT1924506	hsa-miR-620	CLIP-seq
MIRT1924507	hsa-miR-654-5p	CLIP-seq
MIRT761347	hsa-miR-335	CLIP-seq
MIRT2165740	hsa-miR-3918	CLIP-seq
MIRT761358	hsa-miR-425	CLIP-seq
MIRT761363	hsa-miR-4292	CLIP-seq
MIRT2165741	hsa-miR-4307	CLIP-seq
MIRT2165742	hsa-miR-4453	CLIP-seq
MIRT2165743	hsa-miR-4538	CLIP-seq
MIRT2165744	hsa-miR-4760-5p	CLIP-seq
MIRT2165745	hsa-miR-513a-5p	CLIP-seq
MIRT761399	hsa-miR-642b	CLIP-seq
MIRT761404	hsa-miR-766	CLIP-seq
MIRT2383790	hsa-miR-1273f	CLIP-seq
MIRT761316	hsa-miR-1293	CLIP-seq
MIRT2383791	hsa-miR-3689d	CLIP-seq
MIRT761369	hsa-miR-4483	CLIP-seq
MIRT2383792	hsa-miR-4534	CLIP-seq
MIRT761384	hsa-miR-4779	CLIP-seq
MIRT2383793	hsa-miR-4802-5p	CLIP-seq
MIRT1924505	hsa-miR-541	CLIP-seq
MIRT1924507	hsa-miR-654-5p	CLIP-seq
MIRT2383794	hsa-miR-876-3p	CLIP-seq
MIRT2468241	hsa-miR-1205	CLIP-seq
MIRT2468242	hsa-miR-1207-3p	CLIP-seq
MIRT2468243	hsa-miR-1224-3p	CLIP-seq
MIRT2468244	hsa-miR-1225-5p	CLIP-seq
MIRT2468245	hsa-miR-1250	CLIP-seq
MIRT2468246	hsa-miR-1260	CLIP-seq
MIRT2468247	hsa-miR-1260b	CLIP-seq
MIRT2468248	hsa-miR-1261	CLIP-seq
MIRT761313	hsa-miR-1280	CLIP-seq
MIRT1924493	hsa-miR-1305	CLIP-seq
MIRT2468249	hsa-miR-1909	CLIP-seq
MIRT761324	hsa-miR-1913	CLIP-seq
MIRT2468250	hsa-miR-214	CLIP-seq
MIRT2468251	hsa-miR-3064-5p	CLIP-seq
MIRT761334	hsa-miR-31	CLIP-seq
MIRT2468252	hsa-miR-3117-5p	CLIP-seq
MIRT2468253	hsa-miR-3120-5p	CLIP-seq
MIRT2468254	hsa-miR-3123	CLIP-seq
MIRT2468255	hsa-miR-3128	CLIP-seq
MIRT761337	hsa-miR-3140-3p	CLIP-seq
MIRT2468256	hsa-miR-3160-5p	CLIP-seq
MIRT2468257	hsa-miR-3179	CLIP-seq
MIRT2468258	hsa-miR-3183	CLIP-seq
MIRT2468259	hsa-miR-3194-3p	CLIP-seq
MIRT2468260	hsa-miR-3202	CLIP-seq
MIRT2468261	hsa-miR-320e	CLIP-seq
MIRT761343	hsa-miR-324-3p	CLIP-seq
MIRT2468262	hsa-miR-324-5p	CLIP-seq
MIRT1924497	hsa-miR-3613-3p	CLIP-seq
MIRT2468263	hsa-miR-3614-5p	CLIP-seq
MIRT2468264	hsa-miR-3619-5p	CLIP-seq
MIRT2468265	hsa-miR-3664-5p	CLIP-seq
MIRT2468266	hsa-miR-3672	CLIP-seq
MIRT2468267	hsa-miR-3677-5p	CLIP-seq
MIRT1924498	hsa-miR-371-5p	CLIP-seq
MIRT1924499	hsa-miR-371b-5p	CLIP-seq
MIRT2468268	hsa-miR-3907	CLIP-seq
MIRT2468269	hsa-miR-4257	CLIP-seq
MIRT2468270	hsa-miR-4267	CLIP-seq
MIRT2468271	hsa-miR-4271	CLIP-seq
MIRT2468272	hsa-miR-4286	CLIP-seq
MIRT761363	hsa-miR-4292	CLIP-seq
MIRT761364	hsa-miR-4308	CLIP-seq
MIRT2468273	hsa-miR-4311	CLIP-seq
MIRT761368	hsa-miR-4446-5p	CLIP-seq
MIRT2468274	hsa-miR-4455	CLIP-seq
MIRT2468275	hsa-miR-4475	CLIP-seq
MIRT2468276	hsa-miR-4488	CLIP-seq
MIRT2468277	hsa-miR-4505	CLIP-seq
MIRT761373	hsa-miR-4530	CLIP-seq
MIRT2468278	hsa-miR-4536	CLIP-seq
MIRT2468279	hsa-miR-4636	CLIP-seq
MIRT2468280	hsa-miR-4684-5p	CLIP-seq
MIRT2468281	hsa-miR-4690-5p	CLIP-seq
MIRT2468282	hsa-miR-4697-5p	CLIP-seq
MIRT2468283	hsa-miR-4709-5p	CLIP-seq
MIRT2468284	hsa-miR-4716-3p	CLIP-seq
MIRT2468285	hsa-miR-4723-3p	CLIP-seq
MIRT2468286	hsa-miR-4725-3p	CLIP-seq
MIRT2468287	hsa-miR-4731-5p	CLIP-seq
MIRT2468288	hsa-miR-4738-3p	CLIP-seq
MIRT2468289	hsa-miR-4747-5p	CLIP-seq
MIRT2468290	hsa-miR-4749-3p	CLIP-seq
MIRT761381	hsa-miR-4755-5p	CLIP-seq
MIRT761384	hsa-miR-4779	CLIP-seq
MIRT761391	hsa-miR-511	CLIP-seq
MIRT2468291	hsa-miR-579	CLIP-seq
MIRT2468292	hsa-miR-593	CLIP-seq
MIRT2468293	hsa-miR-609	CLIP-seq
MIRT2468294	hsa-miR-625	CLIP-seq
MIRT761398	hsa-miR-635	CLIP-seq
MIRT2468295	hsa-miR-637	CLIP-seq
MIRT2468296	hsa-miR-642a	CLIP-seq
MIRT2468297	hsa-miR-663b	CLIP-seq
MIRT2468298	hsa-miR-664	CLIP-seq
MIRT2468299	hsa-miR-668	CLIP-seq
MIRT2468300	hsa-miR-761	CLIP-seq
MIRT761404	hsa-miR-766	CLIP-seq
MIRT2468301	hsa-miR-890	CLIP-seq
MIRT2468302	hsa-miR-892b	CLIP-seq
MIRT2468241	hsa-miR-1205	CLIP-seq
MIRT2468242	hsa-miR-1207-3p	CLIP-seq
MIRT2468243	hsa-miR-1224-3p	CLIP-seq
MIRT2468244	hsa-miR-1225-5p	CLIP-seq
MIRT2674199	hsa-miR-1245	CLIP-seq
MIRT2468245	hsa-miR-1250	CLIP-seq
MIRT2468246	hsa-miR-1260	CLIP-seq
MIRT2468247	hsa-miR-1260b	CLIP-seq
MIRT2468248	hsa-miR-1261	CLIP-seq
MIRT761313	hsa-miR-1280	CLIP-seq
MIRT761314	hsa-miR-1285	CLIP-seq
MIRT2674200	hsa-miR-1291	CLIP-seq
MIRT761316	hsa-miR-1293	CLIP-seq
MIRT1924493	hsa-miR-1305	CLIP-seq
MIRT2674201	hsa-miR-1825	CLIP-seq
MIRT2468249	hsa-miR-1909	CLIP-seq
MIRT761324	hsa-miR-1913	CLIP-seq
MIRT2468250	hsa-miR-214	CLIP-seq
MIRT2468251	hsa-miR-3064-5p	CLIP-seq
MIRT761334	hsa-miR-31	CLIP-seq
MIRT2468252	hsa-miR-3117-5p	CLIP-seq
MIRT2468253	hsa-miR-3120-5p	CLIP-seq
MIRT761335	hsa-miR-3122	CLIP-seq
MIRT2468254	hsa-miR-3123	CLIP-seq
MIRT2468255	hsa-miR-3128	CLIP-seq
MIRT761337	hsa-miR-3140-3p	CLIP-seq
MIRT2468256	hsa-miR-3160-5p	CLIP-seq
MIRT2674202	hsa-miR-3165	CLIP-seq
MIRT2468258	hsa-miR-3183	CLIP-seq
MIRT761340	hsa-miR-3187-5p	CLIP-seq
MIRT761341	hsa-miR-3188	CLIP-seq
MIRT2468259	hsa-miR-3194-3p	CLIP-seq
MIRT2468261	hsa-miR-320e	CLIP-seq
MIRT761343	hsa-miR-324-3p	CLIP-seq
MIRT2468262	hsa-miR-324-5p	CLIP-seq
MIRT761345	hsa-miR-328	CLIP-seq
MIRT761348	hsa-miR-3612	CLIP-seq
MIRT1924497	hsa-miR-3613-3p	CLIP-seq
MIRT2468263	hsa-miR-3614-5p	CLIP-seq
MIRT2468264	hsa-miR-3619-5p	CLIP-seq
MIRT2674203	hsa-miR-3649	CLIP-seq
MIRT2468265	hsa-miR-3664-5p	CLIP-seq
MIRT2468266	hsa-miR-3672	CLIP-seq
MIRT2468267	hsa-miR-3677-5p	CLIP-seq
MIRT761351	hsa-miR-3689a-3p	CLIP-seq
MIRT761352	hsa-miR-3689c	CLIP-seq
MIRT1924498	hsa-miR-371-5p	CLIP-seq
MIRT1924499	hsa-miR-371b-5p	CLIP-seq
MIRT2468268	hsa-miR-3907	CLIP-seq
MIRT761356	hsa-miR-3913-5p	CLIP-seq
MIRT2468269	hsa-miR-4257	CLIP-seq
MIRT2468270	hsa-miR-4267	CLIP-seq
MIRT2468271	hsa-miR-4271	CLIP-seq
MIRT2468272	hsa-miR-4286	CLIP-seq
MIRT2674204	hsa-miR-4290	CLIP-seq
MIRT761363	hsa-miR-4292	CLIP-seq
MIRT761364	hsa-miR-4308	CLIP-seq
MIRT2468273	hsa-miR-4311	CLIP-seq
MIRT761367	hsa-miR-4443	CLIP-seq
MIRT761368	hsa-miR-4446-5p	CLIP-seq
MIRT2468274	hsa-miR-4455	CLIP-seq
MIRT2468275	hsa-miR-4475	CLIP-seq
MIRT761369	hsa-miR-4483	CLIP-seq
MIRT2468276	hsa-miR-4488	CLIP-seq
MIRT2468277	hsa-miR-4505	CLIP-seq
MIRT761373	hsa-miR-4530	CLIP-seq
MIRT2468278	hsa-miR-4536	CLIP-seq
MIRT2468279	hsa-miR-4636	CLIP-seq
MIRT2674205	hsa-miR-4648	CLIP-seq
MIRT2674206	hsa-miR-4667-3p	CLIP-seq
MIRT2468280	hsa-miR-4684-5p	CLIP-seq
MIRT2468281	hsa-miR-4690-5p	CLIP-seq
MIRT2468282	hsa-miR-4697-5p	CLIP-seq
MIRT2468283	hsa-miR-4709-5p	CLIP-seq
MIRT2468285	hsa-miR-4723-3p	CLIP-seq
MIRT2468286	hsa-miR-4725-3p	CLIP-seq
MIRT761379	hsa-miR-4728-5p	CLIP-seq
MIRT2468287	hsa-miR-4731-5p	CLIP-seq
MIRT2468288	hsa-miR-4738-3p	CLIP-seq
MIRT2468290	hsa-miR-4749-3p	CLIP-seq
MIRT761381	hsa-miR-4755-5p	CLIP-seq
MIRT761382	hsa-miR-4761-5p	CLIP-seq
MIRT761384	hsa-miR-4779	CLIP-seq
MIRT761391	hsa-miR-511	CLIP-seq
MIRT2468291	hsa-miR-579	CLIP-seq
MIRT2468292	hsa-miR-593	CLIP-seq
MIRT2468293	hsa-miR-609	CLIP-seq
MIRT761395	hsa-miR-612	CLIP-seq
MIRT761398	hsa-miR-635	CLIP-seq
MIRT2468295	hsa-miR-637	CLIP-seq
MIRT2468296	hsa-miR-642a	CLIP-seq
MIRT761401	hsa-miR-650	CLIP-seq
MIRT2468297	hsa-miR-663b	CLIP-seq
MIRT2468298	hsa-miR-664	CLIP-seq
MIRT2468299	hsa-miR-668	CLIP-seq
MIRT761402	hsa-miR-670	CLIP-seq
MIRT2468300	hsa-miR-761	CLIP-seq
MIRT761404	hsa-miR-766	CLIP-seq
MIRT2468301	hsa-miR-890	CLIP-seq
MIRT2468302	hsa-miR-892b	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
MYF6	Unknown	11076940
MYOD1	Unknown	11076940
MYOG	Unknown	11076940
SREBF1	Unknown	12764144

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003989	Function	Acetyl-CoA carboxylase activity	IBA
GO:0003989	Function	Acetyl-CoA carboxylase activity	IDA	19236960, 20457939, 20952656, 26976583
GO:0003989	Function	Acetyl-CoA carboxylase activity	IEA
GO:0003989	Function	Acetyl-CoA carboxylase activity	TAS
GO:0005515	Function	Protein binding	IPI	16794074, 20085763, 20457939, 20952656
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10677481
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10677481
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006084	Process	Acetyl-CoA metabolic process	IDA	20952656
GO:0006098	Process	Pentose-phosphate shunt	IEA
GO:0006163	Process	Purine nucleotide metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0009374	Function	Biotin binding	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0016507	Component	Mitochondrial fatty acid beta-oxidation multienzyme complex	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IEA
GO:0042802	Function	Identical protein binding	IPI	20457939
GO:0046322	Process	Negative regulation of fatty acid oxidation	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046722	Process	Lactic acid secretion	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0051289	Process	Protein homotetramerization	IDA	20952656
GO:0055089	Process	Fatty acid homeostasis	TAS
GO:0060421	Process	Positive regulation of heart growth	IEA
GO:0061771	Process	Response to caloric restriction	IEA
GO:0072350	Process	Tricarboxylic acid metabolic process	IEA
GO:0090459	Process	Intracellular aspartate homeostasis	IEA
GO:0090461	Process	Intracellular glutamate homeostasis	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:1903242	Process	Regulation of cardiac muscle hypertrophy in response to stress	IEA
GO:2001295	Process	Malonyl-CoA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
601557	85	ENSG00000076555

O00763

Protein name

Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta)

Protein function

Mitochondrial enzyme that catalyzes the carboxylation of acetyl-CoA to malonyl-CoA and plays a central role in fatty acid metabolism (PubMed:16854592, PubMed:19236960, PubMed:19900410, PubMed:20457939, PubMed:20952656, PubMed:26976583). Catalyze

PDB

2DN8 , 2HJW , 2KCC , 3FF6 , 3GID , 3GLK , 3JRW , 3JRX , 3TDC , 4HQ6 , 5KKN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00289	Biotin_carb_N	259 → 379	Biotin carboxylase, N-terminal domain	Domain
PF02786	CPSase_L_D2	417 → 616	Carbamoyl-phosphate synthase L chain, ATP binding domain	Domain
PF02785	Biotin_carb_C	650 → 758	Biotin carboxylase C-terminal domain	Domain
PF00364	Biotin_lipoyl	895 → 961	Biotin-requiring enzyme	Domain
PF08326	ACC_central	962 → 1688	Acetyl-CoA carboxylase, central region	Family
PF01039	Carboxyl_trans	1780 → 2334	Carboxyl transferase domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in heart, skeletal muscle, liver, adipose tissue, mammary gland, adrenal gland and colon (PubMed:9099716). Isoform 3 is expressed in skeletal muscle, adipose tissue and liver (at protein level) (Pub

Sequence

MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQR
NGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
GTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSV
AGSSRESTRKGSRASLGALSLEAYLTTGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAIRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIAARITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAVKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST

Sequence length

2458

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ACACB-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE, ISOLATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIGH DENSITY LIPOPROTEIN CHOLESTEROL LEVEL QUANTITATIVE TRAIT LOCUS 6	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	23517130, 24510998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	24510998, 28179306, 31325906, 31513709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31984950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	24510998, 28179306, 31325906, 31513709		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30336768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31178227, 34257557, 37893423	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12877803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30341252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30336768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36111743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	23869231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28120895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28120895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28120895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28120895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	27206134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	27206134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20519229, 21908218, 26030797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20519229, 21553357, 21908218, 26030797, 29175208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21887335, 21908218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20519229, 21908218, 34085602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15127202, 20168990, 20514549, 20519229, 21908218, 25262148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	20519229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20514549, 24650564, 26030797, 29175208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32894095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31645659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28081256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28081256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	19846279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	19846279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	32541515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20855566, 21701566, 23562819	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	20519229, 21553357, 25262148, 26030797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20519229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	23517130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27635760, 28081256, 30336768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30721659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20855566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19694967, 20855566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29622456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	20602615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32541515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29605607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24065118, 31513709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	16142397, 29790582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16721829, 19694967, 20439761, 21908218		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19717488, 20439761, 21908218, 34085602	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20882379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	20855566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	21908218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	36233195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34389782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28810559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27693630, 31218122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32299435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32927665	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

ACACB (acetyl-CoA carboxylase beta)