ACACA (acetyl-CoA carboxylase alpha)

Gene

• Entrez ID: 31
• Gene name: Acetyl-CoA carboxylase alpha
• Gene symbol: ACACA
• Synonyms (NCBI Gene): ACAC, ACACAD, ACACalpha, ACC, ACC1, ACCA, ACCalpha, Acac1, hACC1
• Chromosome: 17
• Chromosome location: 17q12
• Summary: Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017082	hsa-miR-335-5p	Microarray	18185580
MIRT030449	hsa-miR-24-3p	Microarray	19748357
MIRT032204	hsa-let-7b-5p	Proteomics	18668040
MIRT032204	hsa-let-7b-5p	CLASH	23622248
MIRT049478	hsa-miR-92a-3p	CLASH	23622248
MIRT046646	hsa-miR-222-3p	CLASH	23622248
MIRT042815	hsa-miR-324-3p	CLASH	23622248
MIRT042815	hsa-miR-324-3p	CLASH	23622248
MIRT042761	hsa-miR-339-5p	CLASH	23622248
MIRT042761	hsa-miR-339-5p	CLASH	23622248
MIRT041233	hsa-miR-193b-3p	CLASH	23622248
MIRT693748	hsa-miR-1255b-2-3p	HITS-CLIP	23313552
MIRT693747	hsa-miR-1250-3p	HITS-CLIP	23313552
MIRT693746	hsa-miR-361-3p	HITS-CLIP	23313552
MIRT693745	hsa-miR-3690	HITS-CLIP	23313552
MIRT693744	hsa-miR-4254	HITS-CLIP	23313552
MIRT693743	hsa-miR-4251	HITS-CLIP	23313552
MIRT693742	hsa-miR-378a-3p	HITS-CLIP	23313552
MIRT693741	hsa-miR-378b	HITS-CLIP	23313552
MIRT693740	hsa-miR-378c	HITS-CLIP	23313552
MIRT693739	hsa-miR-378d	HITS-CLIP	23313552
MIRT693738	hsa-miR-378e	HITS-CLIP	23313552
MIRT693737	hsa-miR-378f	HITS-CLIP	23313552
MIRT693736	hsa-miR-378h	HITS-CLIP	23313552
MIRT693735	hsa-miR-378i	HITS-CLIP	23313552
MIRT693734	hsa-miR-422a	HITS-CLIP	23313552
MIRT693733	hsa-miR-219a-2-3p	HITS-CLIP	23313552
MIRT693732	hsa-miR-6857-3p	HITS-CLIP	23313552
MIRT693731	hsa-miR-4740-5p	HITS-CLIP	23313552
MIRT693730	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT693729	hsa-miR-4515	HITS-CLIP	23313552
MIRT693728	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT693727	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT693726	hsa-miR-580-3p	HITS-CLIP	23313552
MIRT693725	hsa-miR-1269a	HITS-CLIP	23313552
MIRT693724	hsa-miR-1269b	HITS-CLIP	23313552
MIRT693723	hsa-miR-4433b-5p	HITS-CLIP	23313552
MIRT693722	hsa-miR-491-3p	HITS-CLIP	23313552
MIRT693721	hsa-miR-3074-5p	HITS-CLIP	23313552
MIRT693720	hsa-miR-7152-5p	HITS-CLIP	23313552
MIRT693719	hsa-miR-4646-3p	HITS-CLIP	23313552
MIRT441299	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441300	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441299	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441300	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT693748	hsa-miR-1255b-2-3p	HITS-CLIP	23313552
MIRT693747	hsa-miR-1250-3p	HITS-CLIP	23313552
MIRT693746	hsa-miR-361-3p	HITS-CLIP	23313552
MIRT693745	hsa-miR-3690	HITS-CLIP	23313552
MIRT693744	hsa-miR-4254	HITS-CLIP	23313552
MIRT693743	hsa-miR-4251	HITS-CLIP	23313552
MIRT693742	hsa-miR-378a-3p	HITS-CLIP	23313552
MIRT693741	hsa-miR-378b	HITS-CLIP	23313552
MIRT693740	hsa-miR-378c	HITS-CLIP	23313552
MIRT693739	hsa-miR-378d	HITS-CLIP	23313552
MIRT693738	hsa-miR-378e	HITS-CLIP	23313552
MIRT693737	hsa-miR-378f	HITS-CLIP	23313552
MIRT693736	hsa-miR-378h	HITS-CLIP	23313552
MIRT693735	hsa-miR-378i	HITS-CLIP	23313552
MIRT693734	hsa-miR-422a	HITS-CLIP	23313552
MIRT693733	hsa-miR-219a-2-3p	HITS-CLIP	23313552
MIRT693732	hsa-miR-6857-3p	HITS-CLIP	23313552
MIRT693731	hsa-miR-4740-5p	HITS-CLIP	23313552
MIRT693730	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT693729	hsa-miR-4515	HITS-CLIP	23313552
MIRT693728	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT693727	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT693726	hsa-miR-580-3p	HITS-CLIP	23313552
MIRT693725	hsa-miR-1269a	HITS-CLIP	23313552
MIRT693724	hsa-miR-1269b	HITS-CLIP	23313552
MIRT693723	hsa-miR-4433b-5p	HITS-CLIP	23313552
MIRT693722	hsa-miR-491-3p	HITS-CLIP	23313552
MIRT693721	hsa-miR-3074-5p	HITS-CLIP	23313552
MIRT693720	hsa-miR-7152-5p	HITS-CLIP	23313552
MIRT693719	hsa-miR-4646-3p	HITS-CLIP	23313552
MIRT761221	hsa-miR-1224-3p	CLIP-seq
MIRT761222	hsa-miR-1343	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761224	hsa-miR-1912	CLIP-seq
MIRT761225	hsa-miR-1914	CLIP-seq
MIRT761226	hsa-miR-193a-5p	CLIP-seq
MIRT761227	hsa-miR-1976	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT761230	hsa-miR-219-1-3p	CLIP-seq
MIRT761231	hsa-miR-24	CLIP-seq
MIRT761232	hsa-miR-3130-5p	CLIP-seq
MIRT761233	hsa-miR-3607-5p	CLIP-seq
MIRT761234	hsa-miR-3662	CLIP-seq
MIRT761235	hsa-miR-371b-3p	CLIP-seq
MIRT761236	hsa-miR-3925-3p	CLIP-seq
MIRT761237	hsa-miR-3974	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT761239	hsa-miR-4482	CLIP-seq
MIRT761240	hsa-miR-4488	CLIP-seq
MIRT761241	hsa-miR-4491	CLIP-seq
MIRT761242	hsa-miR-4657	CLIP-seq
MIRT761243	hsa-miR-4675	CLIP-seq
MIRT761244	hsa-miR-4697-5p	CLIP-seq
MIRT761245	hsa-miR-4731-5p	CLIP-seq
MIRT761246	hsa-miR-4741	CLIP-seq
MIRT761247	hsa-miR-508-5p	CLIP-seq
MIRT761248	hsa-miR-512-3p	CLIP-seq
MIRT761249	hsa-miR-550a	CLIP-seq
MIRT761250	hsa-miR-571	CLIP-seq
MIRT761251	hsa-miR-572	CLIP-seq
MIRT761252	hsa-miR-582-3p	CLIP-seq
MIRT761253	hsa-miR-582-5p	CLIP-seq
MIRT761254	hsa-miR-637	CLIP-seq
MIRT761255	hsa-miR-105	CLIP-seq
MIRT761256	hsa-miR-1238	CLIP-seq
MIRT761257	hsa-miR-3189-3p	CLIP-seq
MIRT761258	hsa-miR-3914	CLIP-seq
MIRT761259	hsa-miR-4252	CLIP-seq
MIRT761260	hsa-miR-4276	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT761261	hsa-miR-4317	CLIP-seq
MIRT761262	hsa-miR-4504	CLIP-seq
MIRT761263	hsa-miR-4691-5p	CLIP-seq
MIRT761264	hsa-miR-651	CLIP-seq
MIRT761265	hsa-miR-1245b-5p	CLIP-seq
MIRT761266	hsa-miR-1273c	CLIP-seq
MIRT761267	hsa-miR-127-5p	CLIP-seq
MIRT761268	hsa-miR-128	CLIP-seq
MIRT761269	hsa-miR-134	CLIP-seq
MIRT761270	hsa-miR-144	CLIP-seq
MIRT761271	hsa-miR-1827	CLIP-seq
MIRT761272	hsa-miR-18a	CLIP-seq
MIRT761273	hsa-miR-18b	CLIP-seq
MIRT761274	hsa-miR-1909	CLIP-seq
MIRT761225	hsa-miR-1914	CLIP-seq
MIRT761275	hsa-miR-1972	CLIP-seq
MIRT761227	hsa-miR-1976	CLIP-seq
MIRT761276	hsa-miR-200b	CLIP-seq
MIRT761277	hsa-miR-200c	CLIP-seq
MIRT761278	hsa-miR-27a	CLIP-seq
MIRT761279	hsa-miR-27b	CLIP-seq
MIRT761280	hsa-miR-3118	CLIP-seq
MIRT761281	hsa-miR-3142	CLIP-seq
MIRT761282	hsa-miR-3164	CLIP-seq
MIRT761283	hsa-miR-338-3p	CLIP-seq
MIRT761284	hsa-miR-3657	CLIP-seq
MIRT761285	hsa-miR-3683	CLIP-seq
MIRT761286	hsa-miR-370	CLIP-seq
MIRT761287	hsa-miR-3944-5p	CLIP-seq
MIRT761288	hsa-miR-4270	CLIP-seq
MIRT761289	hsa-miR-429	CLIP-seq
MIRT761290	hsa-miR-4435	CLIP-seq
MIRT761291	hsa-miR-4441	CLIP-seq
MIRT761292	hsa-miR-4519	CLIP-seq
MIRT761293	hsa-miR-4530	CLIP-seq
MIRT761294	hsa-miR-4633-5p	CLIP-seq
MIRT761295	hsa-miR-4669	CLIP-seq
MIRT761296	hsa-miR-4685-5p	CLIP-seq
MIRT761297	hsa-miR-4724-3p	CLIP-seq
MIRT761298	hsa-miR-4724-5p	CLIP-seq
MIRT761299	hsa-miR-4733-3p	CLIP-seq
MIRT761300	hsa-miR-4735-3p	CLIP-seq
MIRT761301	hsa-miR-4759	CLIP-seq
MIRT761302	hsa-miR-4762-3p	CLIP-seq
MIRT761303	hsa-miR-4790-3p	CLIP-seq
MIRT761304	hsa-miR-486-5p	CLIP-seq
MIRT761305	hsa-miR-493	CLIP-seq
MIRT761306	hsa-miR-554	CLIP-seq
MIRT761307	hsa-miR-765	CLIP-seq
MIRT761308	hsa-miR-767-3p	CLIP-seq
MIRT761309	hsa-miR-938	CLIP-seq
MIRT761310	hsa-miR-940	CLIP-seq
MIRT761268	hsa-miR-128	CLIP-seq
MIRT761222	hsa-miR-1343	CLIP-seq
MIRT761231	hsa-miR-24	CLIP-seq
MIRT761278	hsa-miR-27a	CLIP-seq
MIRT761279	hsa-miR-27b	CLIP-seq
MIRT1924487	hsa-miR-4284	CLIP-seq
MIRT1924488	hsa-miR-4469	CLIP-seq
MIRT1924489	hsa-miR-4768-5p	CLIP-seq
MIRT1924490	hsa-miR-671-5p	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT761263	hsa-miR-4691-5p	CLIP-seq
MIRT2165703	hsa-miR-1226	CLIP-seq
MIRT761265	hsa-miR-1245b-5p	CLIP-seq
MIRT761266	hsa-miR-1273c	CLIP-seq
MIRT761269	hsa-miR-134	CLIP-seq
MIRT761270	hsa-miR-144	CLIP-seq
MIRT2165704	hsa-miR-1587	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761271	hsa-miR-1827	CLIP-seq
MIRT2165705	hsa-miR-193a-3p	CLIP-seq
MIRT2165706	hsa-miR-193b	CLIP-seq
MIRT761275	hsa-miR-1972	CLIP-seq
MIRT761227	hsa-miR-1976	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT761276	hsa-miR-200b	CLIP-seq
MIRT761277	hsa-miR-200c	CLIP-seq
MIRT761280	hsa-miR-3118	CLIP-seq
MIRT2165707	hsa-miR-3135b	CLIP-seq
MIRT761281	hsa-miR-3142	CLIP-seq
MIRT761282	hsa-miR-3164	CLIP-seq
MIRT2165708	hsa-miR-3176	CLIP-seq
MIRT2165709	hsa-miR-3184	CLIP-seq
MIRT2165710	hsa-miR-3605-3p	CLIP-seq
MIRT2165711	hsa-miR-3614-3p	CLIP-seq
MIRT2165712	hsa-miR-3652	CLIP-seq
MIRT761285	hsa-miR-3683	CLIP-seq
MIRT2165713	hsa-miR-378g	CLIP-seq
MIRT2165714	hsa-miR-3922-3p	CLIP-seq
MIRT761236	hsa-miR-3925-3p	CLIP-seq
MIRT2165715	hsa-miR-3942-3p	CLIP-seq
MIRT2165716	hsa-miR-423-5p	CLIP-seq
MIRT761289	hsa-miR-429	CLIP-seq
MIRT2165717	hsa-miR-4320	CLIP-seq
MIRT2165718	hsa-miR-4417	CLIP-seq
MIRT2165719	hsa-miR-4430	CLIP-seq
MIRT761290	hsa-miR-4435	CLIP-seq
MIRT2165720	hsa-miR-4450	CLIP-seq
MIRT2165721	hsa-miR-4456	CLIP-seq
MIRT2165722	hsa-miR-4492	CLIP-seq
MIRT2165723	hsa-miR-4493	CLIP-seq
MIRT2165724	hsa-miR-4498	CLIP-seq
MIRT761292	hsa-miR-4519	CLIP-seq
MIRT2165725	hsa-miR-4525	CLIP-seq
MIRT761293	hsa-miR-4530	CLIP-seq
MIRT2165726	hsa-miR-4656	CLIP-seq
MIRT2165727	hsa-miR-4660	CLIP-seq
MIRT761243	hsa-miR-4675	CLIP-seq
MIRT2165728	hsa-miR-4677-3p	CLIP-seq
MIRT2165729	hsa-miR-4679	CLIP-seq
MIRT761296	hsa-miR-4685-5p	CLIP-seq
MIRT2165730	hsa-miR-4716-3p	CLIP-seq
MIRT761298	hsa-miR-4724-5p	CLIP-seq
MIRT761245	hsa-miR-4731-5p	CLIP-seq
MIRT761299	hsa-miR-4733-3p	CLIP-seq
MIRT761246	hsa-miR-4741	CLIP-seq
MIRT761301	hsa-miR-4759	CLIP-seq
MIRT2165731	hsa-miR-4778-5p	CLIP-seq
MIRT2165732	hsa-miR-4785	CLIP-seq
MIRT761303	hsa-miR-4790-3p	CLIP-seq
MIRT2165733	hsa-miR-541	CLIP-seq
MIRT2165734	hsa-miR-652	CLIP-seq
MIRT2165735	hsa-miR-762	CLIP-seq
MIRT761307	hsa-miR-765	CLIP-seq
MIRT2165736	hsa-miR-766	CLIP-seq
MIRT2165737	hsa-miR-767-5p	CLIP-seq
MIRT761310	hsa-miR-940	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT2165738	hsa-miR-3617	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT2165723	hsa-miR-4493	CLIP-seq
MIRT2165727	hsa-miR-4660	CLIP-seq
MIRT761263	hsa-miR-4691-5p	CLIP-seq
MIRT2165739	hsa-miR-641	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761221	hsa-miR-1224-3p	CLIP-seq
MIRT2165703	hsa-miR-1226	CLIP-seq
MIRT761268	hsa-miR-128	CLIP-seq
MIRT761222	hsa-miR-1343	CLIP-seq
MIRT2468211	hsa-miR-140-5p	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761224	hsa-miR-1912	CLIP-seq
MIRT761225	hsa-miR-1914	CLIP-seq
MIRT761226	hsa-miR-193a-5p	CLIP-seq
MIRT761227	hsa-miR-1976	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT2468212	hsa-miR-2052	CLIP-seq
MIRT2468213	hsa-miR-2113	CLIP-seq
MIRT761231	hsa-miR-24	CLIP-seq
MIRT761278	hsa-miR-27a	CLIP-seq
MIRT761279	hsa-miR-27b	CLIP-seq
MIRT761232	hsa-miR-3130-5p	CLIP-seq
MIRT2468214	hsa-miR-3140-5p	CLIP-seq
MIRT2468215	hsa-miR-3150a-3p	CLIP-seq
MIRT2468216	hsa-miR-3151	CLIP-seq
MIRT2468217	hsa-miR-3154	CLIP-seq
MIRT2468218	hsa-miR-3157-3p	CLIP-seq
MIRT2468219	hsa-miR-3175	CLIP-seq
MIRT2468220	hsa-miR-3185	CLIP-seq
MIRT2468221	hsa-miR-337-3p	CLIP-seq
MIRT2165710	hsa-miR-3605-3p	CLIP-seq
MIRT2468222	hsa-miR-3611	CLIP-seq
MIRT761234	hsa-miR-3662	CLIP-seq
MIRT761286	hsa-miR-370	CLIP-seq
MIRT761235	hsa-miR-371b-3p	CLIP-seq
MIRT761236	hsa-miR-3925-3p	CLIP-seq
MIRT2468223	hsa-miR-3925-5p	CLIP-seq
MIRT2165715	hsa-miR-3942-3p	CLIP-seq
MIRT2468224	hsa-miR-409-5p	CLIP-seq
MIRT1924487	hsa-miR-4284	CLIP-seq
MIRT2468225	hsa-miR-4290	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT2468226	hsa-miR-4328	CLIP-seq
MIRT2468227	hsa-miR-4447	CLIP-seq
MIRT2468228	hsa-miR-4472	CLIP-seq
MIRT761239	hsa-miR-4482	CLIP-seq
MIRT761240	hsa-miR-4488	CLIP-seq
MIRT2165723	hsa-miR-4493	CLIP-seq
MIRT2468229	hsa-miR-4517	CLIP-seq
MIRT2468230	hsa-miR-4633-3p	CLIP-seq
MIRT761243	hsa-miR-4675	CLIP-seq
MIRT2468231	hsa-miR-4687-3p	CLIP-seq
MIRT761263	hsa-miR-4691-5p	CLIP-seq
MIRT761244	hsa-miR-4697-5p	CLIP-seq
MIRT761245	hsa-miR-4731-5p	CLIP-seq
MIRT761299	hsa-miR-4733-3p	CLIP-seq
MIRT761246	hsa-miR-4741	CLIP-seq
MIRT1924489	hsa-miR-4768-5p	CLIP-seq
MIRT2468232	hsa-miR-4772-3p	CLIP-seq
MIRT2468233	hsa-miR-4773	CLIP-seq
MIRT2468234	hsa-miR-4802-5p	CLIP-seq
MIRT2468235	hsa-miR-491-5p	CLIP-seq
MIRT761247	hsa-miR-508-5p	CLIP-seq
MIRT761248	hsa-miR-512-3p	CLIP-seq
MIRT2468236	hsa-miR-548an	CLIP-seq
MIRT761249	hsa-miR-550a	CLIP-seq
MIRT761251	hsa-miR-572	CLIP-seq
MIRT761252	hsa-miR-582-3p	CLIP-seq
MIRT761253	hsa-miR-582-5p	CLIP-seq
MIRT761254	hsa-miR-637	CLIP-seq
MIRT2165734	hsa-miR-652	CLIP-seq
MIRT2468237	hsa-miR-758	CLIP-seq
MIRT2468238	hsa-miR-769-5p	CLIP-seq
MIRT2468239	hsa-miR-874	CLIP-seq
MIRT2468240	hsa-miR-939	CLIP-seq
MIRT761221	hsa-miR-1224-3p	CLIP-seq
MIRT2674181	hsa-miR-1236	CLIP-seq
MIRT761222	hsa-miR-1343	CLIP-seq
MIRT2468211	hsa-miR-140-5p	CLIP-seq
MIRT2674182	hsa-miR-148a	CLIP-seq
MIRT2674183	hsa-miR-148b	CLIP-seq
MIRT2674184	hsa-miR-149	CLIP-seq
MIRT2674185	hsa-miR-152	CLIP-seq
MIRT761223	hsa-miR-1825	CLIP-seq
MIRT761224	hsa-miR-1912	CLIP-seq
MIRT761225	hsa-miR-1914	CLIP-seq
MIRT761226	hsa-miR-193a-5p	CLIP-seq
MIRT761227	hsa-miR-1976	CLIP-seq
MIRT761228	hsa-miR-199a-5p	CLIP-seq
MIRT761229	hsa-miR-199b-5p	CLIP-seq
MIRT2674186	hsa-miR-2117	CLIP-seq
MIRT2674187	hsa-miR-298	CLIP-seq
MIRT2674188	hsa-miR-3064-5p	CLIP-seq
MIRT761232	hsa-miR-3130-5p	CLIP-seq
MIRT2674189	hsa-miR-3182	CLIP-seq
MIRT761234	hsa-miR-3662	CLIP-seq
MIRT2674190	hsa-miR-3692	CLIP-seq
MIRT761235	hsa-miR-371b-3p	CLIP-seq
MIRT761236	hsa-miR-3925-3p	CLIP-seq
MIRT2674191	hsa-miR-4268	CLIP-seq
MIRT2674192	hsa-miR-4277	CLIP-seq
MIRT761238	hsa-miR-4297	CLIP-seq
MIRT761239	hsa-miR-4482	CLIP-seq
MIRT761240	hsa-miR-4488	CLIP-seq
MIRT761243	hsa-miR-4675	CLIP-seq
MIRT761244	hsa-miR-4697-5p	CLIP-seq
MIRT2674193	hsa-miR-4717-3p	CLIP-seq
MIRT2674194	hsa-miR-4727-5p	CLIP-seq
MIRT761245	hsa-miR-4731-5p	CLIP-seq
MIRT761246	hsa-miR-4741	CLIP-seq
MIRT2674195	hsa-miR-4753-3p	CLIP-seq
MIRT2674196	hsa-miR-4769-3p	CLIP-seq
MIRT2468232	hsa-miR-4772-3p	CLIP-seq
MIRT2674197	hsa-miR-4794	CLIP-seq
MIRT761247	hsa-miR-508-5p	CLIP-seq
MIRT761248	hsa-miR-512-3p	CLIP-seq
MIRT761249	hsa-miR-550a	CLIP-seq
MIRT761251	hsa-miR-572	CLIP-seq
MIRT761253	hsa-miR-582-5p	CLIP-seq
MIRT761254	hsa-miR-637	CLIP-seq
MIRT2674198	hsa-miR-760	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	19842072

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003989	Function	Acetyl-CoA carboxylase activity	IBA
GO:0003989	Function	Acetyl-CoA carboxylase activity	IDA	20457939, 26976583, 29899443
GO:0003989	Function	Acetyl-CoA carboxylase activity	IEA
GO:0003989	Function	Acetyl-CoA carboxylase activity	ISS	20952656
GO:0003989	Function	Acetyl-CoA carboxylase activity	TAS	7905825
GO:0005515	Function	Protein binding	IPI	16326698, 16794074, 18056116, 19343720, 20457939, 20952656, 29899443, 32296183, 38892011
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006084	Process	Acetyl-CoA metabolic process	IEA
GO:0006084	Process	Acetyl-CoA metabolic process	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IC
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	ISS
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016874	Function	Ligase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	20457939
GO:0046872	Function	Metal ion binding	IEA
GO:0046949	Process	Fatty-acyl-CoA biosynthetic process	TAS
GO:0051289	Process	Protein homotetramerization	IEA
GO:0051289	Process	Protein homotetramerization	ISS	20952656
GO:0055088	Process	Lipid homeostasis	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:2001295	Process	Malonyl-CoA biosynthetic process	IEA

Other IDs

• MIM: 200350
• HGNC: 84
• e!Ensembl: ENSG00000278540

Protein

• UniProt ID: Q13085
• Protein name: Acetyl-CoA carboxylase 1 (ACC1) (EC 6.4.1.2) (Acetyl-Coenzyme A carboxylase alpha) (ACC-alpha)
• Protein function: Cytosolic enzyme that catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the first and rate-limiting step of de novo fatty acid biosynthesis (PubMed:20457939, PubMed:20952656, PubMed:29899443). This is a 2 steps reaction starting with the
• PDB: 2YL2, 3COJ, 4ASI, 6G2D, 6G2H, 6G2I, 8XKZ, 8XL0, 8XL1, 8XL2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00289	Biotin_carb_N	117 → 237	Biotin carboxylase, N-terminal domain	Domain
  PF02786	CPSase_L_D2	272 → 473	Carbamoyl-phosphate synthase L chain, ATP binding domain	Domain
  PF02785	Biotin_carb_C	507 → 615	Biotin carboxylase C-terminal domain	Domain
  PF00364	Biotin_lipoyl	752 → 818	Biotin-requiring enzyme	Domain
  PF08326	ACC_central	819 → 1569	Acetyl-CoA carboxylase, central region	Family
  PF01039	Carboxyl_trans	1669 → 2223	Carboxyl transferase domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, placenta, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.
• Sequence:

  MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
  DLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
  VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
  GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
  GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQA
  AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
  QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
  GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
  GVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
  FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
  ESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
  LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
  SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYA
  EIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQ
  STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
  DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
  FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
  MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
  ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
  SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
  SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSP
  PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLV
  DHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
  LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
  YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
  SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
  YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQA
  FLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVI
  GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVD
  PEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGS
  GMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
  EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPID
  RIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
  IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
  MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSI
  NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
  RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLR
  RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE
  EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILST
  MDSPST

• Sequence length: 2346

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acetyl-CoA: carboxylase deficiency	Likely pathogenic; Pathogenic	rs2544608353, rs749657231	RCV002323523 RCV003485860	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ACACA-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ACETYL-COA CARBOXYLASE DEFICIENCY	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon	Ablepharon	BEFREE	29869975		★☆☆☆☆ Found in Text Mining only
Acetyl-CoA: carboxylase deficiency	Acetyl-CoA Carboxylase Deficiency	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	29668854		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	12781057, 26261681		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16786124		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	26446994, 28095038		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	28095038		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28095038, 28332880, 28614035, 30691340		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	10655994, 16131791, 26446994, 28173997, 30092300, 30903866, 31584213, 31645006, 7479776, 9288786		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28713926		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22982105	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	8179602		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	29980676, 31172616		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26385612, 30935991, 31537795		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26385612, 30935991, 31209172, 31537795		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	10655994, 16131791, 26446994, 28173997, 30092300, 30903866, 31584213, 31645006, 7479776, 9288786		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27437649		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28679953		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29886733		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27437649, 28330658, 28627235, 28878828, 29050979, 30571498, 30705337		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28529874		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	15273111		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30395694		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25515860		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30069426, 30130684		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15333468, 16707454, 17372234, 17620310, 17631500, 28993998, 29056512		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17157792, 17631500, 18056116, 26632252, 27506935	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	29558632		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35449157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12877803		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	35032368	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25735330, 25826294, 30841449, 34311471, 34981667, 35449157, 36456877, 40389832	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29056512, 7987312		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23159620	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28984208	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29445083		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28008158		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27437649, 28687710, 28863213, 29050979, 30362921, 30367991, 30619912, 31140347		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37511188	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	24999842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	24999842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Core Myopathy (disorder)	Myopathy	BEFREE	14708096		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	35633176	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	21757917		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31177975		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21049047		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36972768	Associate	★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25049200		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30905361, 31492989		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15142213		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29197582		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28040840, 31740231		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30809968, 35067161, 36328987	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	29667019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29725424		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23507260, 28330658		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31462608		★☆☆☆☆ Found in Text Mining only
Corpus callosum agenesis neuronopathy	Corpus Callosum Agenesis Neuronopathy	BEFREE	17893295, 18566107		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23506543		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30260258		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16984279, 30362921		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28125642	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16984279, 30362921, 31301219		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19390150, 21172433	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19543203	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12149601, 25099943, 28863213, 9568693		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31573977	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30410113, 31604978		★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	29549852		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	32070410	Associate	★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20618176		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	9809981		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29336609		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	24603540, 25474087, 36251517, 37002924	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29309075		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31645659		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	16361810		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	8923835		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30205739		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	16945026		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28081256, 30909789		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28081256, 30909789		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34573317	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	14871250		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10651846		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33274210	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	29667019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	28420803		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26438404		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18031993		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	19846279	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29677194		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21295959		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28863379		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28111356, 30371728, 30827526, 30905361, 30916719, 31011156, 31050695, 31382808, 31481243, 31521481		★☆☆☆☆ Found in Text Mining only
Hypertrichosis	HYPERTRICHOSIS	BEFREE	15126570		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19846279	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27901040		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27901040		★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	29902589		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26452058	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	16361810		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	16247433		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24108210, 29998822		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19390150	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31177975		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29748155		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30905361		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	25049200		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23966553		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14871250, 28561042		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36355448	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	30702114		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21147110		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25735330, 25826294, 26698170, 30244972, 30816537		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30816537		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38066059, 38069382	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17092253, 31694741		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18201362		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29896094, 30069426		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15333468, 16707454, 17372234, 17620310, 17631500, 28993998, 29056512		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	9809981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24956286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30816537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29056512, 7987312		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16061653, 18974063, 29466694, 30899433		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26520441, 30205739		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	24008415		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16061653, 17372234, 22266195, 26261681, 28332880, 28485162, 28744580, 28848043, 28986507, 29232514, 29343429, 30049586, 30809968, 30816537, 30879862		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29197582		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15333468, 17372234, 17631500, 18056116		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30260258		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22388865, 24201868		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30816537, 31454663		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31430206		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29889154		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	28986507		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36410440	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24118457		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	7906211		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30077048		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12634399, 16630136, 16882496, 17372234, 17620310, 24008415, 26261681, 26472150, 26698170, 26768118, 29056512, 29653784, 31325906, 31652963, 9288786		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35633176	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31439721		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	16142397, 28771824, 29790582, 30291215, 31004931, 31756344		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24973952, 27431200, 31325544		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25474087		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19223519, 23805277, 29343429, 31454663		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19543203, 26694359, 36371454	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21184748	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	27876668		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27876668, 28529874		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23549446		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11956967, 29869975		★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	7479776, 9288786		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26458343, 29339197, 30827526		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	26940356		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16061653, 18974063, 29466694		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32258129, 36410440, 37845385, 38049827	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12944983		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29725424		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17235259		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	26255050		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18427872, 28254559, 29998822, 30275258		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19944766, 21658228, 24275578, 30035013, 30852397		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	26472150		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25577251		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24769813	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27693630		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29480015		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25474087, 28935932, 29152143, 29309075		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26520441, 30205739		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26520441	Inhibit	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18493769		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	36861191	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31692082	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11039907		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28008158		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25247297		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989	Associate	★☆☆☆☆ Found in Text Mining only