ABCG2 (ATP binding cassette subfamily G member 2 (JR blood group))

Gene

• Entrez ID: 9429
• Gene name: ATP binding cassette subfamily G member 2 (JR blood group)
• Gene symbol: ABCG2
• Synonyms (NCBI Gene): ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, CDw388, EST157481, GOUT1, MRX, MXR, MXR-1, MXR1, UAQTL1
• Chromosome: 4
• Chromosome location: 4q22.1
• Summary: The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2231137	C>T	Association, affects	Coding sequence variant, missense variant
rs2231142	G>C,T	Not-provided, association, drug-response	Coding sequence variant, missense variant
rs200190472	G>A	Affects	Coding sequence variant, stop gained
rs387906869	TG>-	Affects	Coding sequence variant, frameshift variant
rs387906870	AA>-	Affects	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001952	hsa-miR-520h	Luciferase reporter assay	18189265
MIRT000998	hsa-miR-519c-3p	Western blot, Luciferase reporter assay, qRT-PCR	18573883
MIRT000998	hsa-miR-519c-3p	Luciferase reporter assay	19825807
MIRT001952	hsa-miR-520h	Luciferase reporter assay	19825807
MIRT000081	hsa-miR-328-3p	Review	20026422
MIRT004129	hsa-miR-192-5p	Microarray	16822819
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT001952	hsa-miR-520h	qRT-PCR, Western blot	20628378
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT001952	hsa-miR-520h	Microarray	18189265
MIRT000081	hsa-miR-328-3p	Reporter assay;Western blot;qRT-PCR;Other	19270061
MIRT029929	hsa-miR-26b-5p	Microarray	19088304
MIRT047731	hsa-miR-10a-5p	CLASH	23622248
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	22453125
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437871	hsa-miR-142-3p	Luciferase reporter assay, Western blot	23619912
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31701195
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT759231	hsa-miR-1185	CLIP-seq
MIRT759232	hsa-miR-1206	CLIP-seq
MIRT759233	hsa-miR-1294	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759235	hsa-miR-2117	CLIP-seq
MIRT759236	hsa-miR-3120-3p	CLIP-seq
MIRT759237	hsa-miR-3137	CLIP-seq
MIRT759238	hsa-miR-3144-3p	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT759240	hsa-miR-3545-5p	CLIP-seq
MIRT759241	hsa-miR-3605-5p	CLIP-seq
MIRT759242	hsa-miR-3613-3p	CLIP-seq
MIRT759243	hsa-miR-3614-5p	CLIP-seq
MIRT759244	hsa-miR-365	CLIP-seq
MIRT759245	hsa-miR-3679-5p	CLIP-seq
MIRT759246	hsa-miR-3908	CLIP-seq
MIRT759247	hsa-miR-3936	CLIP-seq
MIRT759248	hsa-miR-3942-5p	CLIP-seq
MIRT759249	hsa-miR-4273	CLIP-seq
MIRT759250	hsa-miR-4316	CLIP-seq
MIRT759251	hsa-miR-4433	CLIP-seq
MIRT759252	hsa-miR-4470	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT759254	hsa-miR-4477a	CLIP-seq
MIRT759255	hsa-miR-4501	CLIP-seq
MIRT759256	hsa-miR-4659a-5p	CLIP-seq
MIRT759257	hsa-miR-4659b-5p	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT759259	hsa-miR-4687-3p	CLIP-seq
MIRT759260	hsa-miR-4703-5p	CLIP-seq
MIRT759261	hsa-miR-4716-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT759264	hsa-miR-4766-3p	CLIP-seq
MIRT759265	hsa-miR-487a	CLIP-seq
MIRT759266	hsa-miR-499-3p	CLIP-seq
MIRT759267	hsa-miR-499a-3p	CLIP-seq
MIRT759268	hsa-miR-548c-3p	CLIP-seq
MIRT759269	hsa-miR-577	CLIP-seq
MIRT759270	hsa-miR-579	CLIP-seq
MIRT759271	hsa-miR-607	CLIP-seq
MIRT759272	hsa-miR-616	CLIP-seq
MIRT759273	hsa-miR-647	CLIP-seq
MIRT759274	hsa-miR-665	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT1923776	hsa-miR-1305	CLIP-seq
MIRT1923777	hsa-miR-145	CLIP-seq
MIRT1923778	hsa-miR-3148	CLIP-seq
MIRT1923779	hsa-miR-3180-5p	CLIP-seq
MIRT1923780	hsa-miR-4427	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT1923781	hsa-miR-4712-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT1923782	hsa-miR-4796-3p	CLIP-seq
MIRT1923783	hsa-miR-548t	CLIP-seq
MIRT1923784	hsa-miR-590-3p	CLIP-seq
MIRT1923785	hsa-miR-770-5p	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT2165278	hsa-miR-4261	CLIP-seq
MIRT2165279	hsa-miR-4282	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT2165280	hsa-miR-4645-3p	CLIP-seq
MIRT2165281	hsa-miR-4652-3p	CLIP-seq
MIRT2165282	hsa-miR-4714-3p	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT2165283	hsa-miR-501-3p	CLIP-seq
MIRT2165284	hsa-miR-502-3p	CLIP-seq
MIRT2165285	hsa-miR-891b	CLIP-seq
MIRT2383765	hsa-miR-3927	CLIP-seq
MIRT2383766	hsa-miR-493	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	20460431
ESR1	Unknown	10342828
MSX2	Unknown	21465479
NFKB1	Activation	10342828
PGR	Unknown	22348324
PPARG	Activation	16785230
RELA	Activation	10342828
SALL4A	Unknown	21526180
SMARCA4	Activation	18234970
SP1	Unknown	21465479

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	18056989, 19909340, 26065921
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18619525, 23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	9861027
GO:0008559	Function	ABC-type xenobiotic transporter activity	IEA
GO:0015143	Function	Urate transmembrane transporter activity	IDA	36749388
GO:0015143	Function	Urate transmembrane transporter activity	IMP	19506252
GO:0015225	Function	Biotin transmembrane transporter activity	ISS
GO:0015562	Function	Efflux transmembrane transporter activity	IBA
GO:0015562	Function	Efflux transmembrane transporter activity	IEA
GO:0015562	Function	Efflux transmembrane transporter activity	IMP	17145775, 19506252
GO:0015562	Function	Efflux transmembrane transporter activity	ISS
GO:0015711	Process	Organic anion transport	ISS
GO:0015747	Process	Urate transport	IEA
GO:0015878	Process	Biotin transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	TAS
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0031526	Component	Brush border membrane	IDA	19506252
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IBA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IDA	17145775
GO:0032218	Process	Riboflavin transport	IDA	17145775
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IBA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IMP	28554189, 30405239
GO:0042802	Function	Identical protein binding	IPI	16870176, 17098188, 19506252, 20399185, 28554189, 29610494
GO:0042803	Function	Protein homodimerization activity	IDA	16870176
GO:0042910	Function	Xenobiotic transmembrane transporter activity	ISS
GO:0045121	Component	Membrane raft	IDA	28623970
GO:0046415	Process	Urate metabolic process	IMP	18834626, 19503597, 20053405
GO:0046624	Function	Sphingolipid transporter activity	TAS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IMP	28554189, 30405239
GO:0070633	Process	Transepithelial transport	IDA	12958161
GO:0097744	Process	Renal urate salt excretion	IMP	19506252
GO:0098591	Component	External side of apical plasma membrane	ISS	18619525
GO:0140115	Process	Export across plasma membrane	ISS
GO:0140359	Function	ABC-type transporter activity	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990748	Process	Cellular detoxification	IDA	9861027
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IC
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IDA	12958161

Other IDs

• MIM: 603756
• HGNC: 74
• e!Ensembl: ENSG00000118777

Protein

• UniProt ID: Q9UNQ0
• Protein name: Broad substrate specificity ATP-binding cassette transporter ABCG2 (EC 7.6.2.2) (ATP-binding cassette sub-family G member 2) (Breast cancer resistance protein) (CDw338) (Mitoxantrone resistance-associated protein) (Placenta-specific ATP-binding cassette t
• Protein function: Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells (PubMed:11306452, PubMed:12958161, PubMed:
• PDB: 5NJ3, 5NJG, 6ETI, 6FEQ, 6FFC, 6HBU, 6HCO, 6HIJ, 6HZM, 6VXF, 6VXH, 6VXI, 6VXJ, 7NEQ, 7NEZ, 7NFD, 7OJ8, 7OJH, 7OJI, 8BHT, 8BI0, 8P7W, 8P8A, 8P8J, 8PXO, 8PY4, 8Q7B, 8QCM, 8U2C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00005	ABC_tran	64 → 214	ABC transporter	Domain
  PF19055	ABC2_membrane_7	243 → 321	ABC-2 type transporter	Family
  PF01061	ABC2_membrane	375 → 586	ABC-2 type transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in placenta (PubMed:9850061). Low expression in small intestine, liver and colon (PubMed:9861027). Expressed in brain (at protein level) (PubMed:12958161). {ECO:0000269|PubMed:12958161, ECO:0000269|PubMed:9850061, ECO:
• Sequence:

  MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
  KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
  SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
  QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
  SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
  DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
  ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
  TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
  MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
  MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
  NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS

• Sequence length: 655

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ABCG2-related disorder	Likely benign; Benign; Affects; association; drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, GOUTY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD GROUP, JUNIOR SYSTEM	Affects; association; Likely benign; Conflicting classifications of pathogenicity; drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYSTAL ARTHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gemcitabine response	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign; association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
rosuvastatin response - Efficacy	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
rosuvastatin response - Metabolism/PK	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETEROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URIC ACID CONCENTRATION, SERUM, QUANTITATIVE TRAIT LOCUS 1	association; Affects; Likely benign; Conflicting classifications of pathogenicity; drug response	ClinVar CTD, ClinVar, HPO CTD, ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	29179472		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10891476, 19635183, 21531129, 22826468, 2930840		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10891476, 12100141, 14574327, 15521915, 15630450, 17434155, 18243305, 21657963, 22037714, 24145140, 24324065, 27960630		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	21640380		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11986944, 15208643, 17368038, 26512967, 28618016		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10611345, 9815736		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15146167		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26951883		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23709101, 24528019, 25603057, 29274627		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25793771		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	27253631		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	15688364		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36555598	Inhibit	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	12761339, 17973979, 20166112, 21488864, 23437103, 24363066, 25118695, 29739804		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14574327, 15630450, 21657963, 22037714, 24145140, 24324065, 27960630		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	17340137, 20122734, 22058196, 24030729		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	17179223, 17494054, 19032367, 21625222		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18946672		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22706241		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33115695	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28011392, 30974102		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31999342	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	20596658, 23301671, 29790111, 31271419		★☆☆☆☆ Found in Text Mining only
Anemia sideroblastic spinocerebellar ataxia	Sideroblastic anemia	Pubtator	30765471	Associate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	19139722		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22360504, 23462326, 24412093, 25890497, 26178481, 29444383, 31378204, 31622355		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	34924131	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20185793		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17505995, 28542262		★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	26552468, 31367212, 35939175, 36221101	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19248091	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	18834626, 20884846, 21768215, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	20884846, 21983786, 23263486, 25676789, 25967671, 27899376, 29453348, 30181573, 30899057, 30924126, 31578528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Gouty	Gouty arthritis	BEFREE	26552468, 31367212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	15946326	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20185793		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20185793	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30201574		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30021380		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	40023574	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17494054, 19032367		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21918980, 25468484, 26035694		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	15542527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	15542527		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	31590928		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	31590928	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	24393808	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28586062, 29397866		★☆☆☆☆ Found in Text Mining only
Borjeson-Forssman-Lehmann syndrome	Borjeson-Forssman-Lehmann Syndrome	BEFREE	11337747		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	15946326, 34008992	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	28747144	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15946326, 23632480, 27052877	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21827403, 23632480, 25640271, 28928160, 29956624, 30237210, 31832814		★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	26883271		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	19967559		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10070941, 11306452, 11346468, 11566359, 11591886, 11948115, 11986944, 12011458, 12946267, 15139851, 15695404, 16540677, 16752223, 17180579, 17380269, 17660947, 18294687, 19333723, 19383836, 19502811, 19514121, 19911699, 20060827, 20110355, 20705611, 20846001, 21106767, 21182469, 21187511, 21487020, 21655989, 21878538, 22198296, 22348324, 22360613, 22436134, 22614107, 22701315, 22750628, 22938493, 23150485, 23288347, 23623923, 23780685, 23988382, 24169358, 24472707, 24718721, 25368234, 25892097, 26091795, 26125275, 26305906, 26546432, 26634205, 26644266, 26700668, 26708059, 26801902, 28282800, 28784290, 28916341, 28935760, 29101532, 29286612, 29454148, 29567542, 30055962, 30181081, 30202239, 30274780, 30570350, 31071369, 31085078, 31157558, 31180052, 31391850, 31408695, 31739702		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	10930538		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12100141, 15047700, 15139851, 15521915, 15930306, 16367905, 16847575, 16925584, 17445775, 18377430, 19165709, 19270061, 19514121, 20004175, 20110355, 20422426, 20705611, 20804740, 21106767, 21487020, 21712253, 21963506, 22198296, 22246505, 22348324, 22449016, 22452996, 22521545, 22701315, 22938493, 23261525, 23288347, 23633119, 23658771, 23988382, 24169358, 24718721, 25198900, 25615818, 25833198, 26091795, 26305906, 26537077, 26634205, 26700668, 26708291, 26801902, 26850786, 27689338, 28098816, 28282800, 28623970, 29286612, 29728077, 31071369, 31180052, 31990564, 32894234, 33844464, 34680166, 35689378, 36344048, 36614168, 36721242, 37166017, 37296582, 37641689, 38409918	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	30055962	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	23838136, 25793771, 26178481, 27709738, 37445716	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15146167, 21175590, 25793771, 31300272		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	24804195	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21943250, 22452996	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17456779, 23153066, 23317196, 29467213, 34031441, 36614168, 37171695	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	27584160	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	38019248	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28586062, 29397866		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26353857		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11162657, 12912956, 19107936, 20385068, 20639455, 21455636, 21566063, 21971989, 22473764, 22978339, 23381786, 23996530, 24939447, 25479544, 25810011, 25988710, 27221310, 27432082, 27911857, 28340578, 29276047, 29552128, 30181510		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22112610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26178481, 29444383, 32629871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16954373, 23467750, 28347288, 35676859, 36555598	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31952518	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	16008690		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	LHGDN	16008690		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16343180, 20019844, 23423781, 24957074, 27466355, 27671528, 30334452, 30536571, 30986993, 31762812		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	16116030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36769209	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	19139722	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	19403814		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	19023099	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19023099		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26583330, 30675209		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22193459, 26583330, 30675209		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14574327, 15630450, 17875533, 18294687, 21657963, 22037714, 24145140, 24324065, 24718721, 27960630, 30849662		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	12145683, 16857811, 17340137		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18946672		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24351404		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36158120, 40282409	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	30608254		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	30608254		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	17159348, 17295178, 22096226, 31136764		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	16890614, 23717540, 25099365		★☆☆☆☆ Found in Text Mining only
Cholestasis, progressive familial intrahepatic 1	Intrahepatic cholestasis	BEFREE	9806540		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11566359, 15634651, 16445700, 19580841, 22681401		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	18042733		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	BEFREE	31367212		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	31367212		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25515305, 26216510, 29393121, 29847376, 30042379, 30181573		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19635183, 19727816, 21918980		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	31392390	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29542407		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33686088	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10070941, 15027118, 18573883, 19240161, 21566063, 22870247, 25226504, 25427584, 27253631, 27257141, 28106284, 29247488, 30392788, 31186779, 31421419		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15027118		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20804740	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37445716	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15027118, 18775442, 19491037, 19930591, 21133588, 21963506, 23173124, 23558935, 23960095, 25793771, 26109419, 26176272, 26386386, 26497773, 27253631, 27257141, 27449042, 28880238, 29247488, 29436100, 29969677, 30066914		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21544799, 22294766		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18573883, 21133588, 22870247, 23558935, 23838136, 24023782, 24338217, 24351404, 25198900, 25793771, 26176272, 27257141, 28212529, 29969677, 31608899, 31724326, 32708825, 33050883, 33671108, 36148682, 37445716, 40362377	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18775442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21544799, 22294766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26176272, 27449042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cone-Rod Dystrophies	Cone-rod dystrophy	BEFREE	11017087		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	11017087		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22116099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15906349, 24825438, 25455500, 26914831, 28347288, 28978010, 30070687		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25634581		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17569884, 25634581, 30305239		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25634581	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25634581		★☆☆☆☆ Found in Text Mining only
Creatine deficiency, X-linked	Creatine deficiency	BEFREE	18350323		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18819034, 21864296, 21940837		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15673927, 18080175, 21050065, 22569626, 23800412, 26092729		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	12761339		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	28100911, 36567334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	31512001		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	16008690		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16902423		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22558111, 24255036, 30610963		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21866211, 22558111, 24255036, 30610963, 31315286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22558111, 24255036, 24342797, 25646370, 30610963		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27328642, 33531564, 34855903	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22558111		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23139370, 24342797, 26993665, 31269743		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	31315286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28503421		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	19032367, 21332310	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	30061363, 31225627		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17179223, 17494054, 19032367, 21625222		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	21625222		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21640380		★☆☆☆☆ Found in Text Mining only
Dysembryoplastic neuroepithelial tumor	Dysembryoplastic Neuroepithelial Tumor	BEFREE	14636345		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32183743	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	36555598	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31512001		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	17938643		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22925688	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33917029, 36555598	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22925688	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20406235		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	15946326	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16188027, 19167193, 21449672, 24586633, 27610747, 28708399, 29791014, 31404235		★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	35338956	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23423781, 24957074, 30986993, 31762812		★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	15546952, 31555729		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24535197, 28964574, 30606658		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24535197, 28964574, 30606658		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36474162	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	22515119	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP F	Fanconi Anemia	BEFREE	22952942		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31630405		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10070941		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	28273590		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	28273590	Associate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	18309947	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	16278376		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	25417047, 30713339, 30879345		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	28335376, 36942304	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12958161, 15993268, 20885358, 21940837, 24380367, 24647572, 25359730, 28370217, 28432589, 29156346		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22401348, 24380367, 25359730, 28019039, 33245508	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36555598	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12958161, 15993268, 20885358, 21810014, 21940837, 24380367, 24647572, 25359730, 28370217, 29156346, 29535786, 31640252		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19265652, 19265662, 19340456, 20697979, 20952483, 24781949, 26883271, 27456282, 28370217, 28432589, 28591733		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23637844, 32238732, 35390338	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	15113040	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	24441388, 25646370, 30894219	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	18834626, 20884846, 21768215, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	18834626, 19890391, 22541845, 23552988, 23774753, 24441388, 24476385, 24857923, 24869748, 24909660, 25326865, 25646370, 25867401, 26427508, 26552468, 26909964, 27249515, 27511497, 27741279, 28252667, 28270222, 28642574, 28855613, 29453348, 29976226, 30181573, 30621105, 30626429, 30894219, 31003562, 31254042, 31367212, 32000861, 32124961, 32164793, 32180207, 33003314, 33669292, 33821957, 34855903, 35264217, 35505381, 35689378, 35939175, 36221101	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	BEFREE	20368174, 24857923, 26909964, 29749379, 31367212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	GWASCAT_DG	20884846, 21983786, 23263486, 25676789, 25967671, 27899376, 29453348, 30181573, 30899057, 30924126, 31578528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	CTD_human_DG	21821808, 31578528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	16902423		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29133573, 31300272		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22009787	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22736676, 24857923, 24869748, 31003562, 32180207	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22116099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Septal Defects	Heart Septal Defects	BEFREE	24979295		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	24979295	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	25446997		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16146333, 17346156, 20406235, 24021215, 26515463		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21918980	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	19447222, 21918980		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	37641689	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	28990842		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	21625222, 22428030, 23423781		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	9425227		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	25867401, 34631016, 40532247	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30522552, 31594719		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25084202		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22558111, 25982326		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25982326	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25084202		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	28577929		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	27988213		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32183743, 34855903, 35505381	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28270772, 30659932		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	25867401, 32183743	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	20472486, 21554546, 22132963, 22132966, 22473008, 23238572, 23493553, 23552988, 24441388, 24476385, 24869748, 24909660, 24940678, 25889045, 26792383, 26835700, 28252667, 28461764, 28566086, 28630638, 28776340, 28968913, 29264928, 29317200, 29342419, 29453348, 29879316, 30197413, 30520504, 30890942, 30894219, 31003562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	CTD_human_DG	21821808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	Pubtator	23238572, 23665398, 24441388, 24476385, 24869748, 24909660, 25867401, 26792383, 28252667, 28458315, 28776340, 29453348, 30197413, 30621105, 30894219, 31003562, 31207883, 31254042, 32000861, 32164793, 32180207, 32183743, 32375679, 33669292, 34631016, 35079028, 35505381, 35939175, 36967798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	GWASCAT_DG	29124443, 29453348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	Pubtator	29317200	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	22216200, 26785721, 32142727	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22452996, 26091795, 28049953	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33326735, 37146419	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31419911		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29132227, 29784015		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31142800		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18819034, 21864296		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31211831	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32375679	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10204842, 10766981, 17546640, 19012350, 21315190		★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	16257066, 17904599		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	26178481		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	28133487, 28784620		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	25099365	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	24441388, 25646370, 30894219	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	16116030		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19023099, 29574357		★☆☆☆☆ Found in Text Mining only
Jaundice, Chronic Idiopathic	Jaundice	BEFREE	9425227		★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	24586633		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31367212		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31367212, 35505381	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34855903	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31691080		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	30181573		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	36344048	Associate	★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	29879316		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10210325, 16051742, 18200595, 18249061, 19635183, 20019844, 30551474, 33650639	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10720143, 19635183, 19949928, 21566063, 26059733, 29661915, 30187992		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21245102	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10891476, 11986234, 12393637, 17340137, 18200595, 18249061, 19846953, 21523728, 21640380, 22508650, 26059733, 27178373, 30766560	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12827650, 1320955, 16029447, 8095167	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10720143, 11986944, 12153153, 12369998, 12393637, 15208643, 15585622, 15607361, 16278398, 16704962, 17072745, 17340137, 17368038, 18200595, 18249061, 20122734, 21523728, 21640380, 24030729, 26002514, 26059733, 26512967, 28618016, 28618074		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11986944, 12369998, 12604403, 15208643, 16278398, 16704962, 18200595		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17627617, 25340731, 26244574, 27845419		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	23047249		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	23047249	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15182435, 20437864, 22922104, 23153066, 24130050, 24391798, 26327240, 28289864, 28819176, 28825695, 28887921, 30698830, 30836216		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18820285		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27543206, 40282409	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	23462698	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37641689	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25798860	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28770824, 29559914		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20437864, 23153066, 28819176		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28463231		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11688982, 15014021, 19107936		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16542215, 18219662, 18588889, 18612434, 19132374, 23996530, 24939447, 25988710, 26536031, 27911857, 32142727, 32478948	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40023574	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21943250, 23838136	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26178481	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21918980	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	17701580		★☆☆☆☆ Found in Text Mining only
MACULAR DEGENERATION, EARLY-ONSET	Macular Degeneration	BEFREE	11017087		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29133573, 31300272		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	17701580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21827403		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	10930538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11306452, 11566359, 11591886, 11948115, 11986944, 12011458, 12946267, 15695404, 16540677, 16752223, 17180579, 17380269, 17660947, 18294687, 19333723, 19383836, 19502811, 19514121, 19911699, 20060827, 20110355, 20705611, 21106767, 21182469, 21187511, 21487020, 21655989, 21878538, 22198296, 22348324, 22360613, 22436134, 22614107, 22701315, 22750628, 22938493, 23150485, 23288347, 23623923, 23780685, 23879965, 23988382, 24169358, 24472707, 24718721, 25368234, 25892097, 26091795, 26125275, 26305906, 26546432, 26644266, 26700668, 26708059, 26801902, 28282800, 28784290, 28916341, 28935760, 29101532, 29286612, 29454148, 29567542, 30055962, 30181081, 30202239, 30274780, 30570350, 31071369, 31085078, 31157558, 31180052, 31391850, 31408695, 31739702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24535197, 28964574, 30606658		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31083682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23467750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26353857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23438193, 30498347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11162657, 12912956, 19107936, 20385068, 20639455, 21455636, 21566063, 21971989, 22473764, 22978339, 23381786, 23996530, 24939447, 25479544, 25810011, 25988710, 27221310, 27432082, 27911857, 28340578, 29276047, 29552128, 30181510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16343180, 20019844, 23423781, 27466355, 27671528, 30334452, 30536571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19117087, 19598259, 20628378, 21956451, 25469510, 26719532, 26785721, 27264047, 29552197, 30285798		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18710444, 20224986, 26459268, 27856956, 28300564		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12100141, 24151392, 27207776, 27257141, 28029654, 30710584, 31364115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30931962		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	24504189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28586062, 29397866		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11162657, 11437380, 11566359, 12369998, 14500392, 14576842, 14636345, 15165903, 15170677, 15753373, 15901850, 15906349, 16309825, 16377077, 17072745, 17234123, 17312388, 17346156, 17494054, 17993230, 18382425, 19111841, 19240161, 19642144, 19708828, 19949928, 20043076, 20159023, 20193106, 20224986, 20424609, 20596658, 20885358, 21151870, 21465479, 21566063, 21770407, 21827403, 22209971, 22328825, 22351672, 22434582, 22549112, 22701315, 22768056, 22821599, 22922104, 22937733, 23153066, 23586460, 23650051, 24021215, 24130050, 24294832, 24472707, 24504189, 24793792, 25105301, 25200103, 25479544, 25542188, 25578561, 25725450, 25781341, 25810011, 26125275, 26176272, 26268246, 26289851, 26324021, 26386386, 26515463, 26556876, 26583330, 26714461, 26927514, 26951883, 27012188, 27196753, 27240991, 27241063, 27257141, 27314299, 27671528, 27689338, 27779650, 27816545, 27856956, 27911857, 28175954, 28212529, 28232025, 28245869, 28323029, 28363332, 28363522, 28438662, 28455266, 28498438, 28597653, 28641010, 28708399, 28887921, 28893612, 29031817, 29291022, 29367724, 29444383, 29458405, 29665654, 29749379, 29808880, 30026175, 30061363, 30070687, 30075623, 30114704, 30181510, 30268729, 30356705, 30391378, 30425643, 30544754, 30675218, 30687102, 30869688, 30890942, 30905807, 31040786, 31083682, 31157558, 31193763, 31254042, 31300272, 31302589, 31452723, 31472682, 31476282, 31639455, 31719146		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29179472		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	18219291		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26583330, 30675209		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15027118, 18573883, 19240161, 21566063, 22870247, 25427584, 26149077, 27253631, 27257141, 28106284, 29247488, 30392788, 31186779, 31421419		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	10930538		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	10930538		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12576456, 14566825, 14576842, 17273774, 18200595, 18255023, 18725232		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15084249, 24736530, 28282800, 28601971		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	10930538		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17701580		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	8706931		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18946672, 25966102		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25966102, 30445362	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	16008690		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16008690, 25115303, 28293855		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16008690		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25300205, 26494317, 28293855, 34296805, 37796710, 39766280	Associate	★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10204842, 10766981, 17546640, 19012350, 21315190		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	10471494, 10644430, 10946355, 12485186, 8826456		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	BEFREE	14628291, 19012350, 9783701		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, WITH OR WITHOUT SEIZURES, ARX-RELATED (disorder)	Mental retardation	BEFREE	17480217		★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	24586633		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21159167		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24827988, 35505381	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24827988, 29393121, 30305239		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	28720764		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	30675218		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11093066		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24415717	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22009787, 23804138, 32957726, 34092610	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	34614057, 36982571	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15899516		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16917002, 19447222, 21321360, 22430632, 25915427, 27253631, 28232025, 28360146, 29784015, 30664164		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16917002, 30664164	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32552614	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33363050	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28720764		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20147974, 21520403, 21693596, 22241070, 23117072, 24123600, 24322003, 24469953, 24581936, 24603487, 26250462, 26354214, 27426203, 27991849, 2930840, 30393497		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21425956		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22558111	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20532215, 22209971, 26081022, 29111349, 29133573		★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	25340731	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11332989, 12473588, 15014021, 15138564, 15146167, 15753373, 16008690, 16061644, 16752223, 18300948, 18393293, 18765824, 18829547, 19265662, 19708828, 19969351, 20159023, 20224986, 20437864, 21332310, 21566063, 21596996, 22328825, 23226356, 23249701, 23288347, 23462326, 23558935, 23879965, 24021215, 24103091, 24294832, 24504189, 24643400, 24781949, 24957074, 25076217, 25427584, 25468484, 25474134, 25603057, 25640271, 25713926, 25892097, 26091795, 26176272, 26386386, 26515463, 26883271, 27033456, 27207776, 27456282, 27552105, 27671528, 27689338, 27692344, 28029654, 28216371, 28282800, 28347288, 28416355, 28586062, 28591733, 28641010, 28822081, 28880238, 29111349, 29156346, 29407974, 29416753, 29454148, 29458405, 29552128, 29956624, 30061363, 30268729, 30406781, 30551474, 31132750, 31175552, 31225627, 31446534, 31729540, 31832814		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29852323		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31367212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	Pubtator	31367212, 36967798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	28577929		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	21064136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurilemmoma	Neurilemmoma	BEFREE	29179472		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19216736, 20236072, 29276047		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19216736, 20072950, 20233711	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21399389, 29956624		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	22807325		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	17627617, 25340731, 26244574, 27845419		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	25340731	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12912956, 15014021, 16303243, 16520985, 17534875, 17618705, 18612434, 19875192, 19900859, 20035425, 20047843, 20975373, 21196162, 21332310, 21455636, 23532985, 23689644, 25200103, 26536031, 26951883, 29440914, 29518481, 30189871, 30194074, 30693031, 31287562, 31486493		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24909660, 26792383, 30305239, 31653704		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26792383, 28458315, 32183743	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	22736676	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22870217, 26300407, 33509236	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25317073, 26251997, 30317661, 30910588		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20019844		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16343180, 18063021, 23423781, 27466355, 27671528, 30334452, 30536571		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16343180		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20019844, 22112610, 24124770, 25611552, 26136502, 28611294, 30526541, 30672151, 32169072, 32894980, 33635609, 35639349, 37990267, 39787968, 40565261	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15688370, 19117087, 19598259, 20628378, 21956451, 25469510, 26719532, 26785721, 27264047, 29552197, 30285798		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26178481, 29444383		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20118824, 20628378, 20922799, 21487324, 25469510, 26785721, 29444383, 33200805	Associate	★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	21544799		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24643400, 28411177		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	26578453		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	26578453	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	24351404	Associate	★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	29179472		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	33805426	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10891476, 27960630		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	14613996		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20019844		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	20019844		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	15542527		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	22112610		★☆☆☆☆ Found in Text Mining only
Progressive intrahepatic cholestasis (disorder)	Intrahepatic Cholestasis	BEFREE	9806540		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18710444, 20224986, 26459268, 27856956, 28300564		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18056989, 18702307		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18056989, 18500686, 18710444, 22216200, 24990514, 28300564	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26459268	Inhibit	★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	35414164	Associate	★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	10811882, 10835642, 11880368, 12901863, 25265166, 26942607, 27994049		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	Pubtator	18936737	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18256692, 31512001		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34680995	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31419911		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	16954373, 27253631		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15906349, 16954373, 23467750, 24825438, 25455500, 26914831, 27253631, 28978010		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28461764		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	11379881		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	11379881		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	16556617, 20157412, 27247490	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19266166, 22328825, 27247490, 27816545		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17131346, 27314299		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	23897011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rod-Cone Dystrophy	Rod-cone dystrophy	BEFREE	11017087		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27314299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	27314299	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	34030451	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Synovial	Synovial sarcoma	Pubtator	23047249	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28264565, 30214039		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30214039	Associate	★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	26110827		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	17340137		★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	15542527		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23558935, 24338217, 25198900, 25677447		★☆☆☆☆ Found in Text Mining only
Sitosterolemia	Sitosterolemia	BEFREE	11099417		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	21655359	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	29181098		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32647186	Inhibit	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	20193106, 21455636, 22389470, 31446534		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19036469, 21455636	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16303243, 24415717, 28340578, 28586062		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17671398		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21678497, 24510239, 30606658		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15113040, 23992541, 24415717, 25275603, 37038789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25275603, 26927514		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	25275603		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	26517090		★☆☆☆☆ Found in Text Mining only
STARGARDT DISEASE 1 (disorder)	Stargardt disease	BEFREE	11017087		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31661303		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10070941, 11332989, 12100141, 24151392, 27257141, 28029654, 30710584, 31364115		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11513878, 12946267, 24151392, 25727099, 26774363, 28029654, 28847472, 28852730, 31364115, 36522839, 37621132	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	28381801		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	34614057	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19023099	Associate	★☆☆☆☆ Found in Text Mining only
Tangier Disease	Tangier Disease	BEFREE	10431238		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	39258697	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25340731, 26914831	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30931962		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17938326		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24643400, 30931962		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37919637	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	26110827		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28586062		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25140317, 28422142, 28750689		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25140317, 37147730, 38019248	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	22870217	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17505995, 19052456, 23512405		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29397866	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26178481, 35379200	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22815634		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22815634	Associate	★☆☆☆☆ Found in Text Mining only