Gene Gene information from NCBI Gene database.
Entrez ID 215
Gene name ATP binding cassette subfamily D member 1
Gene symbol ABCD1
Synonyms (NCBI Gene)
ABC42ALDALDPAMN
Chromosome X
Chromosome location Xq28
Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
SNPs SNP information provided by dbSNP.
86
SNP ID Visualize variation Clinical significance Consequence
rs4010613 C>A,T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs11146842 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs128624214 C>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624215 C>G,T Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624219 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
106
miRTarBase ID miRNA Experiments Reference
MIRT029416 hsa-miR-26b-5p Microarray 19088304
MIRT050424 hsa-miR-23a-3p CLASH 23622248
MIRT039787 hsa-miR-615-3p CLASH 23622248
MIRT053394 hsa-miR-96-5p Microarray 23807165
MIRT758715 hsa-miR-1202 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
115
GO ID Ontology Definition Evidence Reference
GO:0000038 Process Very long-chain fatty acid metabolic process IDA 29397936
GO:0000038 Process Very long-chain fatty acid metabolic process IEA
GO:0000166 Function Nucleotide binding IEA
GO:0002082 Process Regulation of oxidative phosphorylation IEA
GO:0002082 Process Regulation of oxidative phosphorylation ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300371 61 ENSG00000101986
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P33897
Protein name ATP-binding cassette sub-family D member 1 (EC 3.1.2.-) (EC 7.6.2.-) (Adrenoleukodystrophy protein) (ALDP)
Protein function ATP-dependent transporter of the ATP-binding cassette (ABC) family involved in the transport of very long chain fatty acid (VLCFA)-CoA from the cytosol to the peroxisome lumen (PubMed:11248239, PubMed:15682271, PubMed:16946495, PubMed:18757502,
PDB 7RR9 , 7RRA , 7SHM , 7SHN , 7VR1 , 7VWC , 7VX8 , 7VZB , 7X07 , 7X0T , 7X0Z , 7X1W , 7XEC , 7YRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06472 ABC_membrane_2 78 352 ABC transporter transmembrane region 2 Family
PF00005 ABC_tran 490 633 ABC transporter Domain
Sequence
MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGV
AAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR
CIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTY
YRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGT
AWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE
VELALLQRSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPII
TATGYSES
DAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVH
EMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIP
IVTPSGEVVVASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMF
YIPQRPYMSVGSLRDQVIYPDSVEDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCD
WKDVLSGGEKQRIGMARMFYHRPKYALLDECTS
AVSIDVEGKIFQAAKDAGIALLSITHR
PSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQRRLQELCQIL
GEAVAPAHVPAPSPQGPGGLQGAST
Sequence length 745
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
34
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
ABCD1-related disorder Pathogenic; Likely pathogenic rs1057517954, rs2091705296, rs782603062, rs1557052294, rs713993050, rs201568579, rs150346282, rs128624221, rs387906494, rs886044777, rs2522264924, rs2522296936, rs2522276205, rs868911300, rs2522267128
View all (9 more)
RCV003402235
RCV004753460
RCV003892948
RCV004731257
RCV005867934
View all (20 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Abnormality of the nervous system Likely pathogenic rs2148395370 RCV001814562
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adrenoleukodystrophy Pathogenic; Likely pathogenic rs2091708688, rs2091749844, rs1603231784, rs2148389975, rs2148391889, rs2148396070, rs1603231653, rs2148389462, rs2148389592, rs2148389670, rs1204814114, rs2148389834, rs2148391974, rs782007706, rs2148397523
View all (310 more)
RCV001342918
RCV001340427
RCV001368455
RCV001379121
RCV001379281
View all (359 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ehlers-Danlos syndrome, kyphoscoliotic type 1 Likely pathogenic; Pathogenic rs1557054873 RCV004541648
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ADRENOMYELONEUROPATHY HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Addison Disease Addison`s Disease BEFREE 15489218
★☆☆☆☆
Found in Text Mining only
Addison Disease Addison`s Disease HPO_DG
★☆☆☆☆
Found in Text Mining only
Adrenal cortical hypofunction Adrenal Cortical Hypofunction BEFREE 16949688, 17828604, 20228476
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 10068511, 10196381, 10329405, 10480364, 10482273, 10551832, 10980309, 11063720, 11112418, 11422379, 11438993, 11748843, 11810273, 11968085, 11992258
View all (163 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy Pubtator 10068511, 10068516, 11992258, 12065405, 17498713, 17602313, 17609205, 19787628, 20166112, 20228476, 20661612, 21264817, 21966424, 22045812, 22253809
View all (97 more)
Associate
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy CLINVAR_DG 10190819, 10227685, 10480364, 10551832, 10737980, 10815658, 10980309, 10980539, 11102997, 11220738, 11310629, 11336405, 11438993, 11748843, 11798073
View all (95 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy UNIPROT_DG 10369742, 10480364, 10551832, 10737980, 10980539, 11248239, 11438993, 11810273, 15643618, 21700483, 21889498, 23651979, 26686776, 7581394, 7717396
View all (7 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy LHGDN 10737980, 11438993, 11992258, 12579499, 14556192, 17285533, 17662307, 18306728
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy GENOMICS_ENGLAND_DG 11810273, 17372139, 23664929, 24357685, 25655951, 27604308
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adrenoleukodystrophy Adrenoleukodystrophy CLINGEN_DG 15811009, 21700483, 7668254, 7878038, 8651290
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)