ABCC10 (ATP binding cassette subfamily C member 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 89845
• Gene name: ATP binding cassette subfamily C member 10
• Gene symbol: ABCC10
• Synonyms (NCBI Gene): EST182763, MRP7, SIMRP7
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M

miRNA Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047155	hsa-miR-183-5p	CLASH	23622248
MIRT758254	hsa-let-7a	CLIP-seq
MIRT758255	hsa-let-7b	CLIP-seq
MIRT758256	hsa-let-7c	CLIP-seq
MIRT758257	hsa-let-7d	CLIP-seq
MIRT758258	hsa-let-7e	CLIP-seq
MIRT758259	hsa-let-7f	CLIP-seq
MIRT758260	hsa-let-7g	CLIP-seq
MIRT758261	hsa-let-7i	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT758263	hsa-miR-185	CLIP-seq
MIRT758264	hsa-miR-30a	CLIP-seq
MIRT758265	hsa-miR-30b	CLIP-seq
MIRT758266	hsa-miR-30c	CLIP-seq
MIRT758267	hsa-miR-30d	CLIP-seq
MIRT758268	hsa-miR-30e	CLIP-seq
MIRT758269	hsa-miR-3150b-3p	CLIP-seq
MIRT758270	hsa-miR-3911	CLIP-seq
MIRT758271	hsa-miR-3927	CLIP-seq
MIRT758272	hsa-miR-4306	CLIP-seq
MIRT758273	hsa-miR-4323	CLIP-seq
MIRT758274	hsa-miR-4451	CLIP-seq
MIRT758275	hsa-miR-4458	CLIP-seq
MIRT758276	hsa-miR-4495	CLIP-seq
MIRT758277	hsa-miR-4500	CLIP-seq
MIRT758278	hsa-miR-4644	CLIP-seq
MIRT758279	hsa-miR-4685-5p	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT758281	hsa-miR-4765	CLIP-seq
MIRT758282	hsa-miR-4784	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT758284	hsa-miR-98	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT1923634	hsa-miR-1237	CLIP-seq
MIRT1923635	hsa-miR-204	CLIP-seq
MIRT1923636	hsa-miR-211	CLIP-seq
MIRT1923637	hsa-miR-2110	CLIP-seq
MIRT1923638	hsa-miR-4271	CLIP-seq
MIRT1923639	hsa-miR-4314	CLIP-seq
MIRT1923640	hsa-miR-4446-5p	CLIP-seq
MIRT1923641	hsa-miR-4667-5p	CLIP-seq
MIRT1923642	hsa-miR-4700-5p	CLIP-seq
MIRT1923643	hsa-miR-4725-3p	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT1923644	hsa-miR-4755-5p	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT1923645	hsa-miR-623	CLIP-seq
MIRT1923646	hsa-miR-637	CLIP-seq
MIRT1923634	hsa-miR-1237	CLIP-seq
MIRT1923635	hsa-miR-204	CLIP-seq
MIRT1923636	hsa-miR-211	CLIP-seq
MIRT1923637	hsa-miR-2110	CLIP-seq
MIRT2165151	hsa-miR-3664-3p	CLIP-seq
MIRT758270	hsa-miR-3911	CLIP-seq
MIRT1923638	hsa-miR-4271	CLIP-seq
MIRT1923639	hsa-miR-4314	CLIP-seq
MIRT1923640	hsa-miR-4446-5p	CLIP-seq
MIRT1923641	hsa-miR-4667-5p	CLIP-seq
MIRT2165152	hsa-miR-4680-5p	CLIP-seq
MIRT758279	hsa-miR-4685-5p	CLIP-seq
MIRT1923642	hsa-miR-4700-5p	CLIP-seq
MIRT1923643	hsa-miR-4725-3p	CLIP-seq
MIRT1923644	hsa-miR-4755-5p	CLIP-seq
MIRT758281	hsa-miR-4765	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT1923645	hsa-miR-623	CLIP-seq
MIRT1923646	hsa-miR-637	CLIP-seq
MIRT2165153	hsa-miR-671-5p	CLIP-seq
MIRT2165154	hsa-miR-938	CLIP-seq
MIRT758254	hsa-let-7a	CLIP-seq
MIRT758255	hsa-let-7b	CLIP-seq
MIRT758256	hsa-let-7c	CLIP-seq
MIRT758257	hsa-let-7d	CLIP-seq
MIRT758258	hsa-let-7e	CLIP-seq
MIRT758259	hsa-let-7f	CLIP-seq
MIRT758260	hsa-let-7g	CLIP-seq
MIRT758261	hsa-let-7i	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT758269	hsa-miR-3150b-3p	CLIP-seq
MIRT758271	hsa-miR-3927	CLIP-seq
MIRT758273	hsa-miR-4323	CLIP-seq
MIRT758274	hsa-miR-4451	CLIP-seq
MIRT758275	hsa-miR-4458	CLIP-seq
MIRT758277	hsa-miR-4500	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT758282	hsa-miR-4784	CLIP-seq
MIRT758284	hsa-miR-98	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006691	Process	Leukotriene metabolic process	IDA	23087055
GO:0006869	Process	Lipid transport	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IBA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	23087055
GO:0008559	Function	ABC-type xenobiotic transporter activity	IEA
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015431	Function	ABC-type glutathione S-conjugate transporter activity	IDA	23087055
GO:0015431	Function	ABC-type glutathione S-conjugate transporter activity	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	23087055
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0043225	Function	ATPase-coupled inorganic anion transmembrane transporter activity	IEA
GO:0043225	Function	ATPase-coupled inorganic anion transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0071716	Process	Leukotriene transport	IDA	23087055
GO:0071716	Process	Leukotriene transport	IEA
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:0140359	Function	ABC-type transporter activity	IDA	23087055
GO:0140359	Function	ABC-type transporter activity	IEA

Other IDs

• MIM: 612509
• HGNC: 52
• e!Ensembl: ENSG00000124574

Protein

• UniProt ID: Q5T3U5
• Protein name: ATP-binding cassette sub-family C member 10 (EC 7.6.2.2) (EC 7.6.2.3) (Multidrug resistance-associated protein 7)
• Protein function: ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Lipophilic anion transporter that mediates ATP-dependent transport of glucuronide conjugates such as e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00664	ABC_membrane	885 → 1198	ABC transporter transmembrane region	Family
  PF00664	ABC_membrane	285 → 551	ABC transporter transmembrane region	Family
  PF00005	ABC_tran	1263 → 1410	ABC transporter	Domain
  PF00005	ABC_tran	618 → 754	ABC transporter	Domain

• Tissue specificity: TISSUE SPECIFICITY: In testis, localized to peritubular myoid cells, Leydig cells, along the basal membrane of Sertoli cells, moderately in the adluminal compartment of the seminiferous tubules, and in vascular endothelial cells. {ECO:0000269|PubMed:35307
• Sequence:

  MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
  PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
  VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
  ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
  LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
  SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
  NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
  VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
  LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
  LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
  HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
  GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
  EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
  CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
  EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
  AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
  SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
  TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
  VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
  QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
  LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
  NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
  SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
  SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
  NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP

• Sequence length: 1492

Pathways

KEGG Pathway:

ABC transporters

Reactome Pathway:

ABC-family proteins mediated transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	39948438	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	40195560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	35652341, 38965376, 39024449, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	35688625	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 28540026	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	35837087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (30)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17203221		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24937672		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26372358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35363194	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30890141, 31749883		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29082457		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	16857811		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28051999, 31013434		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36585626	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ZNF318 4 shared diseasesSkin neoplasms, Clonal hematopoiesis, Idiopathic pulmonary fibrosis, Kidney failure 5 shared evidence sourcesGWAS catalog (Skin neoplasms), GWAS catalog (Clonal hematopoiesis), GWAS catalog (Heart failure), GWAS catalog (Idiopathic pulmonary fibrosis), GWAS catalog (Kidney failure) Related via 4 shared diseases including Skin neoplasms, Clonal hematopoiesis — evidence mostly GWAS catalog. ABCA8 1 shared diseaseThyroid neoplasms 2 shared pathwaysABC transporters, ABC-family proteins mediated transport 1 shared evidence sourceCTD (Thyroid neoplasms) Related via 2 shared pathways including ABC transporters, ABC-family proteins mediated transport — evidence mostly CTD. ABCB5 2 shared pathwaysABC transporters, ABC-family proteins mediated transport Related via 2 shared pathways including ABC transporters, ABC-family proteins mediated transport. ABCC11 2 shared pathwaysABC transporters, ABC-family proteins mediated transport Related via 2 shared pathways including ABC transporters, ABC-family proteins mediated transport. ABCB9 2 shared pathwaysABC transporters, ABC-family proteins mediated transport Related via 2 shared pathways including ABC transporters, ABC-family proteins mediated transport.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ZNF318	4	["Skin neoplasms","Clonal hematopoiesis","Idiopathic pulmonary fibrosis","Kidney failure"]	0	[]	5	["GWAS catalog (Skin neoplasms)","GWAS catalog (Clonal hematopoiesis)","GWAS catalog (Heart failure)","GWAS catalog (Idiopathic pulmonary fibrosis)","GWAS catalog (Kidney failure)"]
ABCA8	1	["Thyroid neoplasms"]	2	["ABC transporters","ABC-family proteins mediated transport"]	1	["CTD (Thyroid neoplasms)"]
ABCB5	0	[]	2	["ABC transporters","ABC-family proteins mediated transport"]	0	[]
ABCC11	0	[]	2	["ABC transporters","ABC-family proteins mediated transport"]	0	[]
ABCB9	0	[]	2	["ABC transporters","ABC-family proteins mediated transport"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesZNF318, ABCA8, ABCB9 Diabetes mellitus type 2 Linked via 3 of 5 related genesABCA8, ABCB5, ABCB9 Breast neoplasms Linked via 2 of 5 related genesABCA8, ABCC11 Colorectal neoplasms Linked via 2 of 5 related genesABCA8, ABCB5 Metabolic syndrome Linked via 2 of 5 related genesABCA8, ABCB5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["ZNF318","ABCA8","ABCB9"]
Diabetes mellitus type 2	3	["ABCA8","ABCB5","ABCB9"]
Breast neoplasms	2	["ABCA8","ABCC11"]
Colorectal neoplasms	2	["ABCA8","ABCB5"]
Metabolic syndrome	2	["ABCA8","ABCB5"]