ABCC10 (ATP binding cassette subfamily C member 10)

Gene

• Entrez ID: 89845
• Gene name: ATP binding cassette subfamily C member 10
• Gene symbol: ABCC10
• Synonyms (NCBI Gene): EST182763, MRP7, SIMRP7
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047155	hsa-miR-183-5p	CLASH	23622248
MIRT758254	hsa-let-7a	CLIP-seq
MIRT758255	hsa-let-7b	CLIP-seq
MIRT758256	hsa-let-7c	CLIP-seq
MIRT758257	hsa-let-7d	CLIP-seq
MIRT758258	hsa-let-7e	CLIP-seq
MIRT758259	hsa-let-7f	CLIP-seq
MIRT758260	hsa-let-7g	CLIP-seq
MIRT758261	hsa-let-7i	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT758263	hsa-miR-185	CLIP-seq
MIRT758264	hsa-miR-30a	CLIP-seq
MIRT758265	hsa-miR-30b	CLIP-seq
MIRT758266	hsa-miR-30c	CLIP-seq
MIRT758267	hsa-miR-30d	CLIP-seq
MIRT758268	hsa-miR-30e	CLIP-seq
MIRT758269	hsa-miR-3150b-3p	CLIP-seq
MIRT758270	hsa-miR-3911	CLIP-seq
MIRT758271	hsa-miR-3927	CLIP-seq
MIRT758272	hsa-miR-4306	CLIP-seq
MIRT758273	hsa-miR-4323	CLIP-seq
MIRT758274	hsa-miR-4451	CLIP-seq
MIRT758275	hsa-miR-4458	CLIP-seq
MIRT758276	hsa-miR-4495	CLIP-seq
MIRT758277	hsa-miR-4500	CLIP-seq
MIRT758278	hsa-miR-4644	CLIP-seq
MIRT758279	hsa-miR-4685-5p	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT758281	hsa-miR-4765	CLIP-seq
MIRT758282	hsa-miR-4784	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT758284	hsa-miR-98	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT1923634	hsa-miR-1237	CLIP-seq
MIRT1923635	hsa-miR-204	CLIP-seq
MIRT1923636	hsa-miR-211	CLIP-seq
MIRT1923637	hsa-miR-2110	CLIP-seq
MIRT1923638	hsa-miR-4271	CLIP-seq
MIRT1923639	hsa-miR-4314	CLIP-seq
MIRT1923640	hsa-miR-4446-5p	CLIP-seq
MIRT1923641	hsa-miR-4667-5p	CLIP-seq
MIRT1923642	hsa-miR-4700-5p	CLIP-seq
MIRT1923643	hsa-miR-4725-3p	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT1923644	hsa-miR-4755-5p	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT1923645	hsa-miR-623	CLIP-seq
MIRT1923646	hsa-miR-637	CLIP-seq
MIRT1923634	hsa-miR-1237	CLIP-seq
MIRT1923635	hsa-miR-204	CLIP-seq
MIRT1923636	hsa-miR-211	CLIP-seq
MIRT1923637	hsa-miR-2110	CLIP-seq
MIRT2165151	hsa-miR-3664-3p	CLIP-seq
MIRT758270	hsa-miR-3911	CLIP-seq
MIRT1923638	hsa-miR-4271	CLIP-seq
MIRT1923639	hsa-miR-4314	CLIP-seq
MIRT1923640	hsa-miR-4446-5p	CLIP-seq
MIRT1923641	hsa-miR-4667-5p	CLIP-seq
MIRT2165152	hsa-miR-4680-5p	CLIP-seq
MIRT758279	hsa-miR-4685-5p	CLIP-seq
MIRT1923642	hsa-miR-4700-5p	CLIP-seq
MIRT1923643	hsa-miR-4725-3p	CLIP-seq
MIRT1923644	hsa-miR-4755-5p	CLIP-seq
MIRT758281	hsa-miR-4765	CLIP-seq
MIRT758283	hsa-miR-595	CLIP-seq
MIRT1923645	hsa-miR-623	CLIP-seq
MIRT1923646	hsa-miR-637	CLIP-seq
MIRT2165153	hsa-miR-671-5p	CLIP-seq
MIRT2165154	hsa-miR-938	CLIP-seq
MIRT758254	hsa-let-7a	CLIP-seq
MIRT758255	hsa-let-7b	CLIP-seq
MIRT758256	hsa-let-7c	CLIP-seq
MIRT758257	hsa-let-7d	CLIP-seq
MIRT758258	hsa-let-7e	CLIP-seq
MIRT758259	hsa-let-7f	CLIP-seq
MIRT758260	hsa-let-7g	CLIP-seq
MIRT758261	hsa-let-7i	CLIP-seq
MIRT758262	hsa-miR-1225-3p	CLIP-seq
MIRT758269	hsa-miR-3150b-3p	CLIP-seq
MIRT758271	hsa-miR-3927	CLIP-seq
MIRT758273	hsa-miR-4323	CLIP-seq
MIRT758274	hsa-miR-4451	CLIP-seq
MIRT758275	hsa-miR-4458	CLIP-seq
MIRT758277	hsa-miR-4500	CLIP-seq
MIRT758280	hsa-miR-4732-5p	CLIP-seq
MIRT758282	hsa-miR-4784	CLIP-seq
MIRT758284	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006691	Process	Leukotriene metabolic process	IDA	23087055
GO:0006869	Process	Lipid transport	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IBA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	23087055
GO:0008559	Function	ABC-type xenobiotic transporter activity	IEA
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015431	Function	ABC-type glutathione S-conjugate transporter activity	IDA	23087055
GO:0015431	Function	ABC-type glutathione S-conjugate transporter activity	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	23087055
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0043225	Function	ATPase-coupled inorganic anion transmembrane transporter activity	IEA
GO:0043225	Function	ATPase-coupled inorganic anion transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0071716	Process	Leukotriene transport	IDA	23087055
GO:0071716	Process	Leukotriene transport	IEA
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:0140359	Function	ABC-type transporter activity	IDA	23087055
GO:0140359	Function	ABC-type transporter activity	IEA

Other IDs

• MIM: 612509
• HGNC: 52
• e!Ensembl: ENSG00000124574

Protein

• UniProt ID: Q5T3U5
• Protein name: ATP-binding cassette sub-family C member 10 (EC 7.6.2.2) (EC 7.6.2.3) (Multidrug resistance-associated protein 7)
• Protein function: ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Lipophilic anion transporter that mediates ATP-dependent transport of glucuronide conjugates such as e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00664	ABC_membrane	285 → 551	ABC transporter transmembrane region	Family
  PF00005	ABC_tran	618 → 754	ABC transporter	Domain
  PF00664	ABC_membrane	885 → 1198	ABC transporter transmembrane region	Family
  PF00005	ABC_tran	1263 → 1410	ABC transporter	Domain

• Tissue specificity: TISSUE SPECIFICITY: In testis, localized to peritubular myoid cells, Leydig cells, along the basal membrane of Sertoli cells, moderately in the adluminal compartment of the seminiferous tubules, and in vascular endothelial cells. {ECO:0000269|PubMed:35307
• Sequence:

  MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
  PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
  VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
  ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
  LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
  SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
  NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
  VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
  LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
  LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
  HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
  GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
  EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
  CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
  EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
  AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
  SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
  TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
  VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
  QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
  LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
  NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
  SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
  SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
  NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP

• Sequence length: 1492

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17203221		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24937672		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26372358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35363194	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30890141, 31749883		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29082457		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	16857811		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28051999, 31013434		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36585626	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26655271		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17203221		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21628669	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30890141		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19082471		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24937672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30890141, 31749883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29082457		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26708806, 28612064		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24937672, 25402202, 28265007		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	30890141		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	30890141	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18445659, 19082471, 30515095		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29082457		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26708806, 28612064		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26459268, 28612064	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27809359		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	24067562		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31852133	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24937672		★☆☆☆☆ Found in Text Mining only