Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5243
Gene name	ATP binding cassette subfamily B member 1
Gene symbol	ABCB1
Synonyms (NCBI Gene)	ABC20CD243CLCSENPATGP170MDR1P-GPPGY1p-170
Chromosome	7
Chromosome location	7q21.12
Summary	The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

588

Show/Hide all (588)

SNP ID	Visualize variation	Clinical significance	Consequence
rs3842	T>C	Drug-response	3 prime UTR variant
rs17064	T>A	Drug-response	3 prime UTR variant
rs868755	T>A,C,G	Drug-response	Intron variant
rs1016793	G>A	Drug-response	Intron variant
rs1045642	A>C,G,T	Not-provided, drug-response, benign	Missense variant, coding sequence variant, synonymous variant
rs1128501	C>A	Pathogenic	Missense variant, coding sequence variant
rs1128503	A>G	Drug-response, benign	Coding sequence variant, synonymous variant
rs1202168	G>A	Drug-response	Intron variant
rs1202170	C>G,T	Drug-response	Intron variant
rs1211152	A>C,G,T	Drug-response	Intron variant
rs1922240	T>A,C	Drug-response	Intron variant
rs1922242	A>C,T	Drug-response	Intron variant
rs2032582	A>C,T	Not-provided, drug-response, risk-factor, benign	Missense variant, coding sequence variant
rs2032588	G>A	Drug-response	Intron variant
rs2214102	T>A,C,G	Drug-response	Coding sequence variant, 5 prime UTR variant, synonymous variant
rs2214103	C>G	Drug-response	Intron variant
rs2235013	C>A,T	Drug-response	Intron variant
rs2235015	C>A,T	Drug-response, benign	Intron variant
rs2235018	T>C	Drug-response	Intron variant
rs2235019	C>A	Drug-response	Intron variant
rs2235020	T>A,G	Drug-response	Intron variant
rs2235021	C>A	Drug-response	Intron variant
rs2235033	A>G,T	Drug-response	Intron variant
rs2235035	G>A	Drug-response	Intron variant
rs2235046	T>A,C,G	Drug-response	Intron variant
rs2235062	G>A,T	Drug-response	Intron variant
rs2235074	G>A	Drug-response	Intron variant
rs2235075	A>G	Drug-response	Intron variant
rs2888599	C>T	Drug-response	Intron variant
rs3213619	A>G	Drug-response	5 prime UTR variant, intron variant
rs3214119	C>-	Drug-response	Intron variant
rs7809208	A>C	Drug-response	Intron variant
rs9282564	T>A,C,G	Drug-response	Coding sequence variant, missense variant
rs10276036	C>A,T	Drug-response	Intron variant
rs13237132	C>G	Drug-response	Intron variant
rs28381817	T>C	Drug-response	Intron variant
rs28381825	T>C	Drug-response	Intron variant
rs28381827	C>T	Drug-response	Intron variant
rs28381848	T>C	Drug-response	Intron variant
rs28381875	C>T	Drug-response	Intron variant
rs28381877	A>G	Drug-response	Intron variant
rs28381903	C>A	Drug-response	Intron variant
rs28381920	G>A	Drug-response	Intron variant
rs55852620	T>G	Benign, drug-response	Missense variant, coding sequence variant
rs58898486	G>T	Drug-response	Intron variant
rs61040122	G>A	Drug-response	Intron variant
rs61122623	C>T	Drug-response	Missense variant, coding sequence variant
rs115493381	C>A,T	Drug-response	Synonymous variant, coding sequence variant
rs116788440	C>T	Drug-response	Intron variant
rs139611979	C>A,T	Drug-response	Missense variant, coding sequence variant, stop gained
rs141755720	C>A	Drug-response	Intron variant
rs147823195	C>A,T	Drug-response	Coding sequence variant, missense variant
rs192365005	A>C,G	Drug-response	Intron variant
rs199578136	C>T	Drug-response	Missense variant, coding sequence variant
rs199676098	G>A,T	Drug-response	Missense variant, coding sequence variant
rs199779996	C>T	Drug-response	Missense variant, coding sequence variant
rs199939852	T>A	Drug-response	Intron variant
rs200120627	T>A,C	Drug-response	Intron variant
rs200490161	A>C,G	Drug-response	Synonymous variant, coding sequence variant
rs200748388	G>A	Drug-response	5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs201122883	G>A	Drug-response	Missense variant, coding sequence variant
rs201249149	C>A,T	Drug-response	Missense variant, coding sequence variant
rs201280497	C>A,T	Drug-response	Missense variant, coding sequence variant
rs201609930	C>T	Drug-response	Missense variant, coding sequence variant
rs201678613	T>C	Drug-response	Missense variant, coding sequence variant
rs201725784	G>A,T	Drug-response	Missense variant, coding sequence variant
rs202013565	G>A,T	Drug-response	Intron variant
rs202026600	A>G,T	Drug-response	3 prime UTR variant
rs202180045	C>G,T	Drug-response	Intron variant
rs368096241	C>T	Drug-response	Synonymous variant, coding sequence variant
rs373236080	C>A,G,T	Drug-response	Intron variant
rs373789868	C>G,T	Drug-response	Synonymous variant, coding sequence variant
rs377260637	G>A	Drug-response	Intron variant
rs377623963	G>A,T	Drug-response	Intron variant
rs532094830	G>A,C,T	Drug-response	Synonymous variant, missense variant, coding sequence variant
rs539878014	G>A,C,T	Drug-response	Intron variant
rs547093769	A>C,G	Drug-response	Intron variant
rs549753290	G>A,T	Drug-response	3 prime UTR variant
rs565311765	C>T	Drug-response	Intron variant
rs566654614	A>G,T	Drug-response	Intron variant
rs746205498	C>A,G,T	Drug-response	Intron variant
rs746946995	G>C,T	Drug-response	Coding sequence variant, missense variant
rs749904097	A>C,G	Drug-response	3 prime UTR variant
rs750020655	C>A,T	Drug-response	Coding sequence variant, missense variant
rs751270575	G>T	Drug-response	Coding sequence variant, missense variant
rs752103700	C>T	Drug-response	Intron variant
rs753065601	C>T	Drug-response	Coding sequence variant, missense variant
rs754592414	C>T	Drug-response	Intron variant
rs755085099	C>T	Drug-response	Coding sequence variant, missense variant
rs755399685	C>T	Drug-response	Coding sequence variant, synonymous variant
rs756736504	G>A	Drug-response	Coding sequence variant, missense variant
rs756800740	C>T	Drug-response	Coding sequence variant, missense variant
rs756910860	T>A,C	Drug-response	Intron variant
rs757394498	T>C	Drug-response	Coding sequence variant, missense variant
rs758212180	A>C,T	Drug-response	Coding sequence variant, missense variant
rs758454815	A>C,G	Drug-response	Intron variant
rs758834776	C>T	Drug-response	Coding sequence variant, missense variant
rs759177745	C>G,T	Drug-response	Coding sequence variant, missense variant
rs759986853	G>A,C	Drug-response	Coding sequence variant, missense variant
rs761914266	C>A	Drug-response	Coding sequence variant, missense variant
rs762374613	A>G,T	Drug-response	Intron variant
rs762925936	T>C	Drug-response	Intron variant
rs763629745	C>G,T	Drug-response	Intron variant
rs764061195	T>G	Drug-response	Coding sequence variant, missense variant
rs764463583	G>T	Drug-response	Coding sequence variant, missense variant
rs766402999	C>T	Drug-response	Intron variant
rs768893111	C>T	Drug-response	Intron variant
rs769400173	C>G,T	Drug-response	Coding sequence variant, missense variant
rs770657790	C>T	Drug-response	Coding sequence variant, missense variant
rs773338757	C>T	Drug-response	Intron variant
rs776827328	T>C	Drug-response	Coding sequence variant, missense variant
rs778715012	C>A,T	Drug-response	Intron variant
rs779274456	G>C,T	Drug-response	Coding sequence variant, synonymous variant
rs779701045	A>G,T	Drug-response	Intron variant
rs780878256	G>A,C	Drug-response	Intron variant
rs781008688	C>-	Drug-response	3 prime UTR variant
rs887308819	C>T	Drug-response	3 prime UTR variant
rs898222211	G>A,C	Drug-response	Intron variant
rs915714963	T>C,G	Drug-response	Intron variant
rs924572540	C>T	Drug-response	Intron variant
rs928039773	C>T	Drug-response	Intron variant
rs936689901	A>G,T	Drug-response	Intron variant
rs939340150	C>T	Drug-response	Intron variant
rs949343048	A>G	Drug-response	Intron variant
rs957318449	G>A	Drug-response	Missense variant, coding sequence variant
rs962879803	A>G,T	Drug-response	Intron variant
rs982764376	T>A,C	Drug-response	Intron variant
rs987724889	T>C,G	Drug-response	Intron variant
rs989584849	C>A,T	Drug-response	Intron variant
rs1007307351	G>A,C	Drug-response	Intron variant
rs1008523470	G>A	Drug-response	Intron variant
rs1016975479	G>A,C	Drug-response	Intron variant
rs1018001117	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1027598958	G>A,C	Drug-response	Intron variant
rs1031971223	G>A	Drug-response	Coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant, synonymous variant
rs1046963200	C>A,T	Drug-response	Intron variant
rs1049335068	A>C,G	Drug-response	Intron variant
rs1168879904	G>A,T	Drug-response	Coding sequence variant, missense variant
rs1177210906	A>C,T	Drug-response	Intron variant
rs1201355238	T>C,G	Drug-response	3 prime UTR variant
rs1209017436	T>C	Drug-response	Intron variant
rs1215218029	G>A	Drug-response	Intron variant
rs1225969541	G>A,C	Drug-response	Intron variant
rs1229084791	G>A,C	Drug-response	Intron variant
rs1229537494	C>A,T	Drug-response	Intron variant
rs1235811417	T>C,G	Drug-response	Intron variant
rs1239586220	C>A,T	Drug-response	Intron variant
rs1253462004	C>A,T	Drug-response	Coding sequence variant, missense variant
rs1255216813	C>T	Drug-response	Intron variant
rs1259527290	C>T	Drug-response	Coding sequence variant, missense variant
rs1290687132	G>A	Drug-response	Intron variant
rs1291526534	A>T	Drug-response	Intron variant
rs1292455657	C>T	Drug-response	Missense variant, coding sequence variant
rs1297328873	G>A,T	Drug-response	Coding sequence variant, stop gained, synonymous variant
rs1297599774	C>A,T	Drug-response	Intron variant
rs1306027704	G>C,T	Drug-response	Coding sequence variant, missense variant
rs1309545061	T>A,C	Drug-response	Intron variant
rs1317002705	C>A,G	Drug-response	Intron variant
rs1342363724	A>C,G	Drug-response	Intron variant
rs1347885425	GA>-	Drug-response	Intron variant
rs1353988860	C>G,T	Drug-response	Intron variant
rs1354465955	G>T	Drug-response	Intron variant
rs1368229642	C>T	Drug-response	Intron variant
rs1369339362	G>A,T	Drug-response	Intron variant
rs1370607856	C>A	Drug-response	Intron variant
rs1370696292	C>G,T	Drug-response	Intron variant
rs1372487776	C>A,T	Drug-response	Missense variant, coding sequence variant
rs1373455786	C>A,T	Drug-response	Missense variant, coding sequence variant
rs1374940464	C>G,T	Drug-response	Missense variant, coding sequence variant
rs1375773702	C>A,T	Drug-response	Coding sequence variant, synonymous variant
rs1376124155	C>A,G	Drug-response	Intron variant
rs1377795423	C>T	Drug-response	Missense variant, coding sequence variant
rs1380760525	T>C,G	Drug-response	Intron variant
rs1387659216	T>A,C	Drug-response	Intron variant
rs1403432068	G>A	Drug-response	Missense variant, coding sequence variant
rs1410758133	T>A,G	Drug-response	Intron variant
rs1414173164	G>A,C	Drug-response	3 prime UTR variant
rs1415447553	T>C,G	Drug-response	Missense variant, coding sequence variant
rs1421351917	G>A	Drug-response	Stop gained, coding sequence variant
rs1422618705	A>C,T	Drug-response	Intron variant
rs1445722698	T>A,G	Drug-response	Intron variant
rs1455949602	G>A,C	Drug-response	Synonymous variant, coding sequence variant
rs1457191518	A>G,T	Drug-response	Synonymous variant, stop gained, coding sequence variant
rs1459443271	T>C	Drug-response	Intron variant
rs1464634362	A>C,G	Drug-response	Intron variant
rs1465156359	C>G,T	Drug-response	Intron variant
rs1468049509	A>G,T	Drug-response	Intron variant
rs1472049062	C>T	Drug-response	Intron variant
rs1488249711	G>A,T	Drug-response	Intron variant
rs1563045087	C>T	Drug-response	Intron variant
rs1563063804	A>G,T	Drug-response	Intron variant
rs1563063911	C>G,T	Drug-response	Intron variant
rs1584823236	G>A	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823240	A>G	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823244	G>C	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823254	C>T	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823290	T>G	Drug-response	3 prime UTR variant
rs1584823368	A>G	Drug-response	3 prime UTR variant
rs1584823377	A>G	Drug-response	3 prime UTR variant
rs1584823470	T>G	Drug-response	3 prime UTR variant
rs1584823473	T>A	Drug-response	3 prime UTR variant
rs1584823480	C>A	Drug-response	3 prime UTR variant
rs1584823499	G>A	Drug-response	3 prime UTR variant
rs1584823519	C>G	Drug-response	3 prime UTR variant
rs1584823531	C>T	Drug-response	3 prime UTR variant
rs1584823541	T>C	Drug-response	3 prime UTR variant
rs1584823594	C>G	Drug-response	3 prime UTR variant
rs1584823642	T>G	Drug-response	3 prime UTR variant
rs1584823651	C>G	Drug-response	3 prime UTR variant
rs1584823655	T>G	Drug-response	3 prime UTR variant
rs1584823683	T>-	Drug-response	3 prime UTR variant
rs1584823717	A>G	Drug-response	3 prime UTR variant
rs1584823745	G>A	Drug-response	Synonymous variant, coding sequence variant
rs1584823811	A>C	Drug-response	Missense variant, coding sequence variant
rs1584823866	T>C	Drug-response	Missense variant, coding sequence variant
rs1584824009	C>T	Drug-response	Missense variant, coding sequence variant
rs1584824060	A>T	Drug-response	Missense variant, coding sequence variant
rs1584824131	C>T	Drug-response	Missense variant, coding sequence variant
rs1584824153	G>T	Drug-response	Missense variant, coding sequence variant
rs1584824159	A>C	Drug-response	Missense variant, coding sequence variant
rs1584824182	A>C	Drug-response	Intron variant
rs1584826185	A>G	Drug-response	Intron variant
rs1584826310	C>T	Drug-response	Missense variant, coding sequence variant
rs1584826349	C>T	Drug-response	Missense variant, coding sequence variant
rs1584826422	T>G	Drug-response	Missense variant, coding sequence variant
rs1584826433	T>A	Drug-response	Stop gained, coding sequence variant
rs1584826485	G>A	Drug-response	Stop gained, coding sequence variant
rs1584826521	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584826524	G>A	Drug-response	Intron variant
rs1584826607	G>A	Drug-response	Intron variant
rs1584826651	T>G	Drug-response	Intron variant
rs1584829568	C>A	Drug-response	Missense variant, coding sequence variant
rs1584829602	C>T	Drug-response	Missense variant, coding sequence variant
rs1584829608	G>C	Drug-response	Missense variant, coding sequence variant
rs1584829753	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584829851	C>T	Drug-response	Intron variant
rs1584829872	C>T	Drug-response	Intron variant
rs1584834617	A>C	Drug-response	Splice donor variant
rs1584834623	A>C	Drug-response	Missense variant, coding sequence variant
rs1584834796	C>T	Drug-response	Missense variant, coding sequence variant
rs1584834848	A>C	Drug-response	Synonymous variant, coding sequence variant
rs1584834899	T>C	Drug-response	Missense variant, coding sequence variant
rs1584834930	C>T	Drug-response	Missense variant, coding sequence variant
rs1584835033	G>T	Drug-response	Synonymous variant, coding sequence variant
rs1584835130	A>C	Drug-response	Intron variant
rs1584835173	A>G	Drug-response	Intron variant
rs1584835202	C>G,T	Drug-response	Intron variant
rs1584835214	T>A	Drug-response	Intron variant
rs1584835244	T>G	Drug-response	Intron variant
rs1584836629	A>C	Drug-response	Intron variant
rs1584836644	C>A	Drug-response	Intron variant
rs1584836653	A>G	Drug-response	Intron variant
rs1584836737	C>T	Drug-response	Missense variant, coding sequence variant
rs1584840431	T>C	Drug-response	Intron variant
rs1584840436	T>A	Drug-response	Intron variant
rs1584840439	A>T	Drug-response	Intron variant
rs1584840441	G>A	Drug-response	Intron variant
rs1584840613	G>A	Drug-response	Stop gained, coding sequence variant
rs1584840650	A>G	Drug-response	Missense variant, coding sequence variant
rs1584840663	G>T	Drug-response	Intron variant
rs1584840710	G>A	Drug-response	Intron variant
rs1584841757	C>A	Drug-response	Intron variant
rs1584841967	G>A	Drug-response	Intron variant
rs1584841973	A>G	Drug-response	Intron variant
rs1584852928	A>G	Drug-response	Intron variant
rs1584852932	G>A	Drug-response	Intron variant
rs1584853136	A>C	Drug-response	Missense variant, coding sequence variant
rs1584853146	C>T	Drug-response	Missense variant, coding sequence variant
rs1584853152	A>C	Drug-response	Missense variant, coding sequence variant
rs1584857518	C>A	Drug-response	Intron variant
rs1584857539	A>T	Drug-response	Intron variant
rs1584857543	A>C	Drug-response	Intron variant
rs1584857558	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584857640	C>T	Drug-response	Splice acceptor variant
rs1584859774	C>A	Drug-response	Intron variant
rs1584859789	G>C	Drug-response	Intron variant
rs1584859927	C>T	Drug-response	Missense variant, coding sequence variant
rs1584859968	G>C	Drug-response	Intron variant
rs1584860048	A>C	Drug-response	Intron variant
rs1584861751	C>A	Drug-response	Intron variant
rs1584861789	C>A	Drug-response	Splice donor variant
rs1584861846	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584861940	G>A	Drug-response	Missense variant, coding sequence variant
rs1584861948	T>A	Drug-response	Missense variant, coding sequence variant
rs1584861959	C>T	Drug-response	Missense variant, coding sequence variant
rs1584861968	G>A	Drug-response	Missense variant, coding sequence variant
rs1584862080	G>A	Drug-response	Intron variant
rs1584862137	G>A	Drug-response	Intron variant
rs1584862144	C>-	Drug-response	Intron variant
rs1584862188	G>A	Drug-response	Intron variant
rs1584862195	T>-	Drug-response	Intron variant
rs1584864515	G>A	Drug-response	Intron variant
rs1584864525	A>C	Drug-response	Intron variant
rs1584864535	T>G	Drug-response	Intron variant
rs1584864540	C>A	Drug-response	Intron variant
rs1584864555	A>G	Drug-response	Intron variant
rs1584864582	G>A	Drug-response	Intron variant
rs1584864590	C>A	Drug-response	Intron variant
rs1584864714	C>T	Drug-response	Missense variant, coding sequence variant
rs1584864725	C>T	Drug-response	Missense variant, coding sequence variant
rs1584864743	T>A	Drug-response	Missense variant, coding sequence variant
rs1584864863	A>T	Drug-response	Intron variant
rs1584864874	GGA>-	Drug-response	Intron variant
rs1584864880	A>T	Drug-response	Intron variant
rs1584864890	C>A	Drug-response	Intron variant
rs1584864923	T>C	Drug-response	Intron variant
rs1584865238	C>A	Drug-response	Intron variant
rs1584865310	A>C	Drug-response	Intron variant
rs1584865377	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584865847	A>-	Drug-response	Intron variant
rs1584866513	A>G	Drug-response	Intron variant
rs1584866517	T>C	Drug-response	Intron variant
rs1584866531	A>G	Drug-response	Intron variant
rs1584866539	T>C	Drug-response	Intron variant
rs1584866716	T>C	Drug-response	Missense variant, coding sequence variant
rs1584866897	T>-	Drug-response	Intron variant
rs1584867527	T>G	Drug-response	Intron variant
rs1584867530	A>C	Drug-response	Intron variant
rs1584867532	C>A	Drug-response	Intron variant
rs1584867557	A>C	Drug-response	Intron variant
rs1584870154	A>G	Drug-response	Intron variant
rs1584870236	A>T	Drug-response	Intron variant
rs1584870326	A>C	Drug-response	Missense variant, coding sequence variant
rs1584870462	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870522	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870562	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870588	A>G	Drug-response	Intron variant
rs1584870644	A>T	Drug-response	Intron variant
rs1584870717	G>T	Drug-response	Intron variant
rs1584870734	C>T	Drug-response	Intron variant
rs1584870737	T>A	Drug-response	Intron variant
rs1584870744	A>T	Drug-response	Intron variant
rs1584870801	C>T	Drug-response	Intron variant
rs1584870839	A>-	Drug-response	Intron variant
rs1584871120	G>T	Drug-response	Missense variant, coding sequence variant
rs1584871159	C>T	Drug-response	Missense variant, coding sequence variant
rs1584871252	C>-	Drug-response	Intron variant
rs1584871266	TG>-	Drug-response	Intron variant
rs1584871277	C>A	Drug-response	Intron variant
rs1584871295	G>A	Drug-response	Intron variant
rs1584871312	A>G	Drug-response	Intron variant
rs1584871355	G>A	Drug-response	Intron variant
rs1584871437	C>G	Drug-response	Missense variant, coding sequence variant
rs1584871479	T>C	Drug-response	Synonymous variant, coding sequence variant
rs1584871482	G>A	Drug-response	Synonymous variant, coding sequence variant
rs1584871494	T>G	Drug-response	Missense variant, coding sequence variant
rs1584871513	C>A	Drug-response	Missense variant, coding sequence variant
rs1584871572	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584871577	C>T	Drug-response	Missense variant, coding sequence variant
rs1584871582	T>C	Drug-response	Missense variant, coding sequence variant
rs1584871639	T>A	Drug-response	Missense variant, coding sequence variant
rs1584871672	G>A	Drug-response	Intron variant
rs1584871701	A>T	Drug-response	Intron variant
rs1584871706	G>A	Drug-response	Intron variant
rs1584871734	T>G	Drug-response	Intron variant
rs1584871788	C>T	Drug-response	Intron variant
rs1584871842	T>C	Drug-response	Missense variant, coding sequence variant
rs1584871861	G>A	Drug-response	Stop gained, coding sequence variant
rs1584871933	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584871947	A>T	Drug-response	Missense variant, coding sequence variant
rs1584871955	G>A	Drug-response	Missense variant, coding sequence variant
rs1584872123	C>T	Drug-response	Intron variant
rs1584872136	A>-	Drug-response	Intron variant
rs1584872141	G>T	Drug-response	Intron variant
rs1584872146	G>-	Drug-response	Intron variant
rs1584872159	A>G	Drug-response	Intron variant
rs1584872191	A>T	Drug-response	Intron variant
rs1584872207	G>A	Drug-response	Intron variant
rs1584872301	A>T	Drug-response	Missense variant, coding sequence variant
rs1584872342	T>G	Drug-response	Synonymous variant, coding sequence variant
rs1584872360	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584872372	C>T	Drug-response	Missense variant, coding sequence variant
rs1584872523	A>-	Drug-response	Intron variant
rs1584875156	T>G	Drug-response	Intron variant
rs1584875166	T>C	Drug-response	Intron variant
rs1584875299	C>T	Drug-response	Missense variant, coding sequence variant
rs1584875420	A>T	Drug-response	Missense variant, coding sequence variant
rs1584875429	C>T	Drug-response	Missense variant, coding sequence variant
rs1584875546	T>G	Drug-response	Intron variant
rs1584875572	G>A	Drug-response	Intron variant
rs1584875617	A>G	Drug-response	Intron variant
rs1584875679	G>A	Drug-response	Intron variant
rs1584875690	C>-	Drug-response	Intron variant
rs1584875732	G>A	Drug-response	Intron variant
rs1584875845	A>C	Drug-response	Intron variant
rs1584876051	G>A	Drug-response	Intron variant
rs1584876122	G>T	Drug-response	Intron variant
rs1584876165	T>A	Drug-response	Intron variant
rs1584876196	T>C	Drug-response	Intron variant
rs1584876204	G>T	Drug-response	Intron variant
rs1584876354	A>C	Drug-response	Intron variant
rs1584880914	G>A	Drug-response	Intron variant
rs1584880919	T>C	Drug-response	Intron variant
rs1584881029	C>G	Drug-response	Intron variant
rs1584881050	A>C	Drug-response	Intron variant
rs1584881055	T>A	Drug-response	Intron variant
rs1584881535	G>C	Drug-response	Intron variant
rs1584881586	A>-	Drug-response	Intron variant
rs1584881633	C>T	Drug-response	Missense variant, coding sequence variant
rs1584881689	A>C	Drug-response	Missense variant, coding sequence variant
rs1584881716	A>G	Drug-response	Synonymous variant, coding sequence variant
rs1584881721	C>T	Drug-response	Missense variant, coding sequence variant
rs1584882616	T>C	Drug-response	Intron variant
rs1584882620	C>T	Drug-response	Intron variant
rs1584882625	T>C	Drug-response	Intron variant
rs1584882718	C>A	Drug-response	Intron variant
rs1584882723	A>T	Drug-response	Intron variant
rs1584885500	A>G	Drug-response	Intron variant
rs1584885509	T>C	Drug-response	Intron variant
rs1584885551	A>C	Drug-response	Intron variant
rs1584885852	G>A	Drug-response	Intron variant
rs1584885927	C>T	Drug-response	Intron variant
rs1584886037	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886062	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886072	A>C	Drug-response	Missense variant, coding sequence variant
rs1584886173	A>G	Drug-response	Intron variant
rs1584886228	A>G	Drug-response	Intron variant
rs1584886384	T>A	Drug-response	Intron variant
rs1584886392	T>C	Drug-response	Intron variant
rs1584886492	C>T	Drug-response	Intron variant
rs1584886587	T>-	Drug-response	Intron variant
rs1584886661	C>T	Drug-response	Intron variant
rs1584886694	G>-	Drug-response	Coding sequence variant, frameshift variant
rs1584886735	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584886768	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886787	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584886875	C>A	Drug-response	Synonymous variant, coding sequence variant
rs1584886962	T>A	Drug-response	Missense variant, coding sequence variant
rs1584886995	A>-	Drug-response	Intron variant
rs1584887050	C>A	Drug-response	Intron variant
rs1584887226	G>A	Drug-response	Intron variant
rs1584887273	A>T	Drug-response	Intron variant
rs1584887296	G>T	Drug-response	Intron variant
rs1584887312	A>T	Drug-response	Intron variant
rs1584887315	A>G,T	Drug-response	Intron variant
rs1584887330	A>T	Drug-response	Intron variant
rs1584887344	C>-	Drug-response	Intron variant
rs1584887358	A>-	Drug-response	Intron variant
rs1584887366	T>-	Drug-response	Intron variant
rs1584889692	G>A	Drug-response	Intron variant
rs1584889697	G>T	Drug-response	Intron variant
rs1584889701	C>T	Drug-response	Intron variant
rs1584889708	C>A	Drug-response	Intron variant
rs1584889711	A>T	Drug-response	Intron variant
rs1584889722	A>C	Drug-response	Intron variant
rs1584889733	T>G	Drug-response	Intron variant
rs1584889745	A>C	Drug-response	Intron variant
rs1584889754	C>T	Drug-response	Intron variant
rs1584889859	G>T	Drug-response	Intron variant
rs1584889905	A>G	Drug-response	Intron variant
rs1584889940	C>A	Drug-response	Intron variant
rs1584889961	T>G	Drug-response	Intron variant
rs1584890095	C>A	Drug-response	Stop gained, coding sequence variant
rs1584890130	G>A	Drug-response	Missense variant, coding sequence variant
rs1584890268	G>A	Drug-response	Intron variant
rs1584890282	A>G	Drug-response	Intron variant
rs1584890294	G>A	Drug-response	Intron variant
rs1584901639	A>C	Drug-response	Intron variant
rs1584901651	A>G	Drug-response	Intron variant
rs1584901654	A>C	Drug-response	Intron variant
rs1584901803	C>-	Drug-response	Intron variant
rs1584901860	C>T	Drug-response	Intron variant
rs1584901891	T>C	Drug-response	Intron variant
rs1584901896	G>A	Drug-response	Intron variant
rs1584901920	G>T	Drug-response	Intron variant
rs1584901951	A>T	Drug-response	Intron variant
rs1584901984	T>C	Drug-response	Intron variant
rs1584901992	T>C	Drug-response	Intron variant
rs1584901996	A>G	Drug-response	Intron variant
rs1584902000	G>C	Drug-response	Intron variant
rs1584902074	T>C	Drug-response	Intron variant
rs1584902150	C>A	Drug-response	Intron variant
rs1584902180	A>G	Drug-response	Intron variant
rs1584902204	G>A	Drug-response	Intron variant
rs1584902218	G>T	Drug-response	Intron variant
rs1584902264	T>-	Drug-response	Intron variant
rs1584902271	C>T	Drug-response	Intron variant
rs1584902336	C>T	Drug-response	Missense variant, coding sequence variant
rs1584902348	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584902369	C>T	Drug-response	Missense variant, coding sequence variant
rs1584902411	AG>-	Drug-response	Coding sequence variant, frameshift variant
rs1584902425	G>A	Drug-response	Missense variant, coding sequence variant
rs1584902437	C>A	Drug-response	Missense variant, coding sequence variant
rs1584902466	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584902579	A>G	Drug-response	Synonymous variant, coding sequence variant
rs1584902591	A>-	Drug-response	Intron variant
rs1584902609	A>-	Drug-response	Intron variant
rs1584902619	G>-	Drug-response	Intron variant
rs1584902756	A>T	Drug-response	Intron variant
rs1584910469	A>G	Drug-response	Intron variant
rs1584910473	G>A	Drug-response	Intron variant
rs1584910478	T>C	Drug-response	Intron variant
rs1584910554	C>T	Drug-response	Intron variant
rs1584910566	A>T	Drug-response	Intron variant
rs1584910621	C>G	Drug-response	Intron variant
rs1584910858	C>G	Drug-response	Intron variant
rs1584910872	T>G	Drug-response	Intron variant
rs1584910875	T>C	Drug-response	Intron variant
rs1584910879	A>C	Drug-response	Intron variant
rs1584910893	T>A	Drug-response	Intron variant
rs1584910898	T>A	Drug-response	Intron variant
rs1584910901	G>T	Drug-response	Intron variant
rs1584910904	T>A	Drug-response	Intron variant
rs1584910912	T>A	Drug-response	Intron variant
rs1584910920	T>A,C	Drug-response	Intron variant
rs1584910934	C>T	Drug-response	Intron variant
rs1584910945	T>C	Drug-response	Intron variant
rs1584910949	C>T	Drug-response	Intron variant
rs1584910952	T>C	Drug-response	Intron variant
rs1584910957	C>T	Drug-response	Intron variant
rs1584910973	C>T	Drug-response	Intron variant
rs1584911001	T>C	Drug-response	Intron variant
rs1584911038	C>-	Drug-response	Intron variant
rs1584911058	G>C	Drug-response	Intron variant
rs1584911161	A>C	Drug-response	Missense variant, coding sequence variant
rs1584911169	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584911173	G>A	Drug-response	Missense variant, coding sequence variant
rs1584911190	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584911230	A>C	Drug-response	Intron variant
rs1584911242	A>C	Drug-response	Intron variant
rs1584911245	A>C	Drug-response	Intron variant
rs1584911250	A>C	Drug-response	Intron variant
rs1584911254	A>C	Drug-response	Intron variant
rs1584911259	A>C	Drug-response	Intron variant
rs1584911271	A>C	Drug-response	Intron variant
rs1584911278	A>C	Drug-response	Intron variant
rs1584911288	A>C	Drug-response	Intron variant
rs1584911315	A>T	Drug-response	Intron variant
rs1584911850	A>G	Drug-response	Intron variant
rs1584911855	A>G	Drug-response	Intron variant
rs1584911860	C>T	Drug-response	Intron variant
rs1584911866	T>C	Drug-response	Intron variant
rs1584911872	G>A	Drug-response	Intron variant
rs1584911877	C>T	Drug-response	Intron variant
rs1584912048	C>G	Drug-response	Intron variant
rs1584913947	T>G	Drug-response	Intron variant
rs1584913955	T>A	Drug-response	Intron variant
rs1584913959	G>A	Drug-response	Intron variant
rs1584913965	A>T	Drug-response	Intron variant
rs1584913986	A>T	Drug-response	Intron variant
rs1584914074	G>T	Drug-response	Intron variant
rs1584914222	T>A	Drug-response	Intron variant
rs1584914264	A>T	Drug-response	Intron variant
rs1584914268	A>C	Drug-response	Intron variant
rs1584914270	A>G	Drug-response	Intron variant
rs1584914289	C>T	Drug-response	Splice donor variant
rs1584914478	T>G	Drug-response	Intron variant
rs1584914521	G>T	Drug-response	Intron variant
rs1584914617	G>A	Drug-response	Intron variant
rs1584914629	G>A	Drug-response	Intron variant
rs1584914719	T>G	Drug-response	Intron variant
rs1584914842	T>G	Drug-response	Intron variant
rs1584914908	T>C	Drug-response	Intron variant
rs1584914912	T>C	Drug-response	Intron variant
rs1584914920	C>T	Drug-response	Intron variant
rs1584914926	T>C	Drug-response	Intron variant
rs1584914929	A>G	Drug-response	Intron variant
rs1584914931	G>A	Drug-response	Intron variant
rs1584914953	T>C	Drug-response	Intron variant
rs1584914976	C>T	Drug-response	Intron variant
rs1584915016	G>A	Drug-response	Intron variant
rs1584915038	G>A	Drug-response	Intron variant
rs1584915041	G>A	Drug-response	Intron variant
rs1584915050	T>A	Drug-response	5 prime UTR variant, missense variant, coding sequence variant
rs1584915094	A>C	Drug-response	5 prime UTR variant, intron variant
rs1584915124	C>T	Drug-response	5 prime UTR variant, intron variant
rs1584915134	C>A	Drug-response	5 prime UTR variant, intron variant
rs1584915145	A>G	Drug-response	5 prime UTR variant, intron variant
rs1584915173	T>C	Drug-response	5 prime UTR variant, intron variant
rs1584915238	G>A	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915251	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915278	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915282	G>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915287	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915300	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915306	G>A	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915309	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915313	A>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915332	A>G	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915353	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915357	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915362	C>A	Drug-response	Stop gained, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915370	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915387	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915392	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915394	G>A	Drug-response	Stop gained, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915409	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915415	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005656	hsa-miR-451a	qRT-PCRLuciferase reporter assayWestern blot	18645025
MIRT054152	hsa-miR-129-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25344911
MIRT054152	hsa-miR-129-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25344911
MIRT054158	hsa-miR-508-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23893241
MIRT054158	hsa-miR-508-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23893241
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT731564	hsa-miR-186-5p	Luciferase reporter assay	26626440
MIRT731564	hsa-miR-186-5p	Luciferase reporter assay	26626440
MIRT054152	hsa-miR-129-5p	Luciferase reporter assayqRT-PCRWestern blot	28012924
MIRT054152	hsa-miR-129-5p	Luciferase reporter assayqRT-PCRWestern blot	28012924
MIRT733751	hsa-miR-214-3p	Luciferase reporter assayqRT-PCRWestern blotting	32095078
MIRT733751	hsa-miR-214-3p	Luciferase reporter assayWestern blottingqRT-PCR	32095078
MIRT755917	hsa-miR-224-5p	Luciferase reporter assayWestern blottingqRT-PCR	35426328
MIRT758129	hsa-miR-223	CLIP-seq
MIRT758130	hsa-miR-3153	CLIP-seq
MIRT758131	hsa-miR-455-3p	CLIP-seq
MIRT758132	hsa-miR-4668-5p	CLIP-seq
MIRT758133	hsa-miR-582-5p	CLIP-seq
MIRT758134	hsa-miR-935	CLIP-seq

Show/Hide all (40)

Transcription factor	Regulation	Reference
CDX2	Unknown	20699370
CEBPB	Activation	15044620
E2F1	Activation	23542036
EAPP	Activation	23542036
EGR1	Activation	11488907;7565762
EGR1	Unknown	10392899;10860921
EP300	Unknown	22154511
ETS1	Activation	20392592
HDAC1	Repression	19435809;20037778
HDAC1	Unknown	20037778
HIF1A	Repression	12067980
HIPK2	Unknown	20646448
HSF1	Unknown	10816597
JUN	Activation	10369069
MBD1	Unknown	17667922
MECP2	Unknown	11865062
MYCN	Repression	7923112
NFKB1	Activation	19763573
NFKB1	Repression	12527911
NFKB1	Unknown	18234965
NFYA	Unknown	18234965;22154511
NFYB	Unknown	18234965
NFYC	Unknown	18234965
NR1I2	Activation	18540626
PITX2	Unknown	23354914
RELA	Activation	19763573
RELA	Unknown	18234965
SIRT1	Activation	20713551
SP1	Activation	10644769;7565762
SP1	Unknown	10860921;8103518
TCF4	Activation	20459685
TCF7L2	Unknown	10987283
TP53	Repression	10029407
TP53	Unknown	18234965
UHRF1	Repression	20037778
WT1	Unknown	10392899;10860921
YBX1	Activation	10644769
YBX1	Repression	17072343
YBX1	Unknown	18234965
ZNRD1	Activation	16373708

123

Show/Hide all (123)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19384922
GO:0000166	Function	Nucleotide binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001890	Process	Placenta development	IEA
GO:0005515	Function	Protein binding	IPI	17088979, 20711237
GO:0005524	Function	ATP binding	IDA	28757552, 29371429
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	3768958
GO:0005737	Component	Cytoplasm	IDA	35970996
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	18619525, 23137377, 35970996
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	26850595, 28757552
GO:0008559	Function	ABC-type xenobiotic transporter activity	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IGI	23893241, 28260112
GO:0008559	Function	ABC-type xenobiotic transporter activity	IMP	28411377
GO:0008559	Function	ABC-type xenobiotic transporter activity	TAS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	TAS	3022150
GO:0009914	Process	Hormone transport	IEA
GO:0009986	Component	Cell surface	IDA	19384922
GO:0010046	Process	Response to mycotoxin	IEA
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	26850595, 28587984, 28757552
GO:0015562	Function	Efflux transmembrane transporter activity	IGI	23893241, 28260112
GO:0015562	Function	Efflux transmembrane transporter activity	IMP	25986174, 28411377
GO:0016020	Component	Membrane	IDA	26006083
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3022150, 3768958
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	8898203, 16361082, 28408210, 31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0022857	Function	Transmembrane transporter activity	ISS
GO:0031526	Component	Brush border membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	26006083
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0035633	Process	Maintenance of blood-brain barrier	IEA
GO:0036146	Process	Cellular response to mycotoxin	IEA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IBA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IDA	28757552
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	TAS	3022150
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IBA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	28587984, 28757552
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	25986174
GO:0043215	Process	Daunorubicin transport	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0045332	Process	Phospholipid translocation	IBA
GO:0045332	Process	Phospholipid translocation	IDA	8898203
GO:0045332	Process	Phospholipid translocation	IEA
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046865	Process	Terpenoid transport	ISS
GO:0046943	Function	Carboxylic acid transmembrane transporter activity	IMP	25986174
GO:0050892	Process	Intestinal absorption	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0060856	Process	Establishment of blood-brain barrier	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070633	Process	Transepithelial transport	IDA	28757552
GO:0070633	Process	Transepithelial transport	IMP	25986174
GO:0071217	Process	Cellular response to external biotic stimulus	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071236	Process	Cellular response to antibiotic	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071475	Process	Cellular hyperosmotic salinity response	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0072089	Process	Stem cell proliferation	IMP	19384922
GO:0090554	Function	Phosphatidylcholine floppase activity	IBA
GO:0090554	Function	Phosphatidylcholine floppase activity	IDA	8898203
GO:0090554	Function	Phosphatidylcholine floppase activity	IEA
GO:0090555	Function	Phosphatidylethanolamine flippase activity	IDA	8898203
GO:0097068	Process	Response to thyroxine	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0097327	Process	Response to antineoplastic agent	IEA
GO:0098591	Component	External side of apical plasma membrane	ISS	18619525
GO:0099038	Function	Ceramide floppase activity	IDA	8898203
GO:0099040	Process	Ceramide translocation	IBA
GO:0099040	Process	Ceramide translocation	IDA	8898203
GO:0140115	Process	Export across plasma membrane	IDA	28587984
GO:0140115	Process	Export across plasma membrane	IMP	25986174
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	IEA
GO:0140328	Function	Floppase activity	IMP	8898203
GO:0140359	Function	ABC-type transporter activity	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1902065	Process	Response to L-glutamate	IEA
GO:1902396	Process	Protein localization to bicellular tight junction	IEA
GO:1903416	Process	Response to glycoside	IEA
GO:1904057	Process	Negative regulation of sensory perception of pain	IEA
GO:1904148	Process	Cellular response to nonylphenol	IEA
GO:1904446	Process	Positive regulation of establishment of Sertoli cell barrier	IEA
GO:1904478	Process	Regulation of intestinal absorption	IEA
GO:1905039	Process	Carboxylic acid transmembrane transport	IMP	25986174
GO:1905231	Process	Cellular response to borneol	IEA
GO:1905232	Process	Cellular response to L-glutamate	IEA
GO:1905233	Process	Response to codeine	IEA
GO:1905235	Process	Response to quercetin	IEA
GO:1905237	Process	Response to cyclosporin A	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IDA	26850595
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IGI	23893241
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IMP	28260112, 28411377
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	TAS	25344911
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IC	28757552
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IEA
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IMP	25986174
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	ISS	28587984
GO:1990963	Process	Establishment of blood-retinal barrier	IEA
GO:2001025	Process	Positive regulation of response to drug	IEA
GO:2001225	Process	Regulation of chloride transport	IMP	7828597

MIM	HGNC	e!Ensembl
171050	40	ENSG00000085563

P08183

Protein name

ATP-dependent translocase ABCB1 (ATP-binding cassette sub-family B member 1) (Multidrug resistance protein 1) (EC 7.6.2.2) (P-glycoprotein 1) (Phospholipid transporter ABCB1) (EC 7.6.2.1) (CD antigen CD243)

Protein function

Translocates drugs and phospholipids across the membrane (PubMed:2897240, PubMed:35970996, PubMed:8898203, PubMed:9038218, PubMed:35507548). Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membran

PDB

6C0V , 6FN1 , 6FN4 , 6QEX , 7A65 , 7A69 , 7A6C , 7A6E , 7A6F , 7O9W , 8Y6H , 8Y6I , 9CR8 , 9CTC , 9CTF , 9CTG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00664	ABC_membrane	51 → 343	ABC transporter transmembrane region	Family
PF00005	ABC_tran	410 → 559	ABC transporter	Domain
PF00664	ABC_membrane	711 → 986	ABC transporter transmembrane region	Family
PF00005	ABC_tran	1053 → 1204	ABC transporter	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in small intestine (PubMed:28408210). Expressed in liver, kidney and brain. {ECO:0000269|PubMed:28408210}.

Sequence

MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ

Sequence length

1280

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
COLCHICINE RESISTANCE	Pathogenic	rs1128501	RCV000014697	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Idiopathic generalized epilepsy	Likely pathogenic	rs2117129739	RCV001509550	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (84)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ABCB1-related disorder	Benign; Likely benign; drug response; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTISOCIAL PERSONALITY DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYOGLOBULINEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL MEDITERRANEAN FEVER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIAS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPITUITARISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION, ORTHOSTATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease 13	Uncertain significance; Benign	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INTRAHEPATIC CHOLESTASIS OF PREGNANCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MDR1 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAUSEA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tramadol response	Benign; Conflicting classifications of pathogenicity; drug response; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (811)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	28714181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19784880, 20801494, 20801498, 23148794, 25542807, 29936693, 31778598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	1673636, 17852455, 2202383, 29990841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10198619, 10500774, 10500786, 10897123, 11185984, 12028995, 1283551, 1380280, 16522547, 16614510, 18271955, 1859877, 18702870, 19635183, 21133625 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10897123, 11323101, 11531016, 11801309, 11849207, 11964305, 12028995, 12410571, 12691146, 12780787, 1283551, 12851703, 14618619, 14712291, 15102684 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	8528062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10214864, 10233413, 10374860, 10500779, 10500792, 11301107, 11986944, 12010657, 1283551, 12926083, 15109536, 15217827, 17038891, 18001833, 19288261 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10602414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	10500792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	10602414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	12368167, 16223781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15108165, 16223781, 7516029, 8555497, 9516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	1444203, 15070089, 15856298, 16819187, 18443954, 2481665, 26632382, 29979729, 30721703, 3681376, 7669560, 9066608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16214115, 16819187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10399951, 12788075, 1673331, 17003290, 17340576, 20041327, 22363234, 26026084, 28411043, 31023123, 31810914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15070089, 20377486, 29174985, 31527404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11135430, 18054347, 19107762, 26515462, 27995666, 29768255, 30230544, 31201909, 7903701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	1358618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11929704, 19250544, 23977225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19250544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10987283, 16166436, 16323173, 29805510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	1974900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	CTD_human_DG	12015757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	12015757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	1675220, 29411361, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10897123, 11531016, 12410571, 12851703, 14618619, 14712291, 16382213, 16522547, 17875533, 18385010, 19352661, 19467705, 19564743, 20423567, 22037714 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10214864, 11986944, 12010657, 15217827, 16278398, 17038891, 17340137, 17688368, 18271955, 18644389, 31307954, 8558937, 8709631, 9322679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23088763, 25379720, 26211578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26261589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21762523, 25840583, 31811017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18473730, 18946672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	1978691, 9516147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	29411361, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	17683514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	17211591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	27683125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15975076, 17617464, 21478475, 21718295, 26827652, 31064831, 33115695, 36142507, 37264161, 40168071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40023574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26827652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21478475, 25213397, 27915995, 28093288, 30354871, 30877973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19146924, 27158936, 28011392, 28779378, 29704642, 30974102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31999342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	35853630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10630353, 11391622, 9020393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	21332314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	11391622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	20596658, 29534964, 29790111, 7812988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	29679725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24704000, 25881102, 26641474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25881102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22430884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27636225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28151874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	34924131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	18348284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	25918995	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	20859246, 28502879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	32015454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20859246, 28502879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	29411361, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	27747906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27925244, 31521892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16504991, 20080907, 27323187, 28132103, 29670920, 30532219, 33017281, 36724603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	25712147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20940624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26598078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10630353, 12125964, 17429576, 9020393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28137267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11461099, 11529503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerotic Parkinsonism	Atherosclerotic Parkinsonism	CTD_human_DG	26457621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27261537, 28208135, 30770140, 31520256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32899083, 37420302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	20166790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	29369497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20166790		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	28470827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10773966, 10773967, 17290357, 21847519, 24486577, 25712147, 28154898, 28207188, 28534442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12181055, 12829023, 15569157, 28534442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	40023574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	19570321, 8001500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11260300, 21300134, 21912938, 25586740, 26376998, 28000873, 28036258, 28123543, 28587395, 31815420, 31819366		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11114132, 17085864, 1972761, 25586345, 25964294, 7484017, 8105101, 8241511, 9074409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	14752243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	LHGDN	14752243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	CTD_human_DG	17015054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21218380, 22705826, 24898446		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	1682037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22269388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15342374, 15930345, 16323173, 18242387, 24344919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	26001650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18165917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29668471, 36698099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	36698099	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11156211, 20689757, 21292509, 21935574, 22986993, 24601223, 26657501, 26717965, 28676933, 28714514, 30349370, 30967374, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1976871, 22975581, 2639725, 27416909, 7914748, 9031075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	23116553, 27641736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	10088973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	21955855, 25582575, 9920827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	24083708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	24083708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	15473912, 20921883, 34008992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23896815, 25891836, 26400323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10678554, 11391622, 12125964, 1346632, 1682428, 21827403, 28137267, 31832814, 8645582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28137267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	26883271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	11391622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	30245967, 7905787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	19093112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10092063, 10369069, 10381498, 10597187, 10960771, 11313874, 11346468, 11355955, 11391630, 11466674, 11803466, 12115804, 12174911, 12467215, 12533839 View all (236 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10381498, 10638986, 11305953, 11346468, 11355955, 11509559, 11937596, 1355661, 1357834, 15034303, 15047700, 15771955, 15986399, 16168133, 16309213 View all (116 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	36867605	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	29352737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	19484794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	23152970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28207188, 29948283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	32171300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	7905944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	23803057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11351043, 17300681, 19331170, 23977225, 27709738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25793771	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10446694, 10656626, 10896996, 1358617, 1359152, 14669341, 15262134, 15379935, 1676033, 1697346, 17177989, 1835847, 19250544, 1977924, 22154301 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	21332314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	20056007, 8766529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12428063	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15112342, 15948236, 16521213, 16733848, 17666793, 19322916, 19447220, 20085590, 22927901, 23037162, 23109454, 23317199, 23532266, 23792120, 23925649 View all (16 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20056007, 24093668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	24013781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11156211, 20689757, 20840328, 21292509, 21935574, 22986993, 24601223, 26657501, 26717965, 28676933, 28714514, 30349370, 30967374, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10048981, 10357555, 10399954, 11305953, 11724293, 11745426, 1309222, 16087181, 1679564, 17120199, 17259654, 17409824, 17895794, 18656688, 19107762 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19603017, 20921883, 23917080, 32429133, 33326171, 36799490, 7863796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32243098, 32375296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10190320, 10839301, 1672598, 17177989, 19393132, 19552816, 1967174, 21199801, 23462807, 2481665, 25861751, 31007253, 33838279, 36077583, 8698736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35163092	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12073053, 17120199, 28099906, 30865384, 31952518, 8543635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma testes	Testicular carcinoma	BEFREE	9669816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	1680203, 7848886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10680335, 11780384, 11863219, 1359152, 16288028, 16467099, 16803472, 1682037, 17001177, 17143487, 17828752, 17913048, 18765553, 19040611, 1973872 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	21332314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12364568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	12364568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20801494, 29397568, 29936693, 39459499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24328528, 25118983, 29350207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	8647899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	20453713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	LHGDN	15975076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	15975076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	24138987, 27915995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18622260, 19106083, 20801494, 22177087, 22810051, 30742211		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	1697346, 22245869, 28447725, 31424649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22245869, 28447725, 31424649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10500775, 10897123, 11531016, 12410571, 12851703, 14618619, 14712291, 15059065, 15543372, 15717687, 16522547, 17548681, 17568669, 17875533, 18385010 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	11986944, 12430927, 17340137, 17688368, 18228020, 18271955, 31307954, 8558937, 8709631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26261589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18473730, 18946672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23822562, 28422725, 30784212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28422725, 32334452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	Pubtator	14526408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	15138130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	25612754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	15684063, 29867509, 9360432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, progressive familial intrahepatic 1	Intrahepatic cholestasis	BEFREE	18049123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10632461, 19445670, 24789077, 9702400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	19445670, 37148005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	21143841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	21143841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16445700, 22681401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19762492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17376299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	17700595, 23926124, 25014506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	9150348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10233413, 10456659, 11114132, 1347708, 1355660, 1360821, 14636414, 17085864, 1709806, 17107902, 18335218, 1911388, 19635183, 1972761, 20496015 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9746764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21243282, 26327575, 29791609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	23803057, 31738228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	26625351, 28485529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24717943, 27577924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	33978213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	12007018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	16788565, 23462807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	34032749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	19760622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	12176916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	16783494, 19896502, 24517233, 30854958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	11077043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	20030680, 8099135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33731765, 40168071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	40168071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12512026, 14610718, 16773678, 19288029, 20361960, 21350189, 26557010, 28401939, 29891588, 30412370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	14610718, 16462040, 17206635, 21830274, 22661185, 23537364, 24838898, 25526204, 25755800, 29543864, 36450761, 37090740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10399951, 11052631, 12370750, 12625868, 12788075, 12894558, 1355483, 15742416, 15912392, 1671638, 1681110, 1682280, 17003290, 17163579, 17237282 View all (50 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	36411191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16107775, 16819187, 17541169, 17579122, 18414651, 20217131, 21382175, 2481665, 24901645, 31527404, 33974673, 37187089, 7738186, 8098614, 8912533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17404718, 17541169, 17674045, 7513140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17541169, 17671692, 18673531, 19020725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10630353, 11323103, 11678332, 11839557, 11901227, 12297834, 12894567, 15222051, 1537074, 15742416, 16702732, 16800822, 17146660, 17674045, 18474294 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	22294766, 23977225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11676863, 1355483, 15222051, 16702732, 16800822, 18267032, 18673531, 19192650, 19250544, 19298255, 20177420, 20533057, 22394004, 22396794, 22460269 View all (52 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11980438, 17146660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11980438, 12011154, 18474294		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	22294766, 23977225		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25793771	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28146436	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27999186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	BEFREE	23717663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	28288183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of vas deferens	Absent vas deferens	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10088973, 10702900, 10949987, 11237063, 11426533, 11480556, 12010657, 17107902, 21091151, 8603335, 9678611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23167387, 23822562, 25632187, 30784212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	21183151, 23874772, 31086358		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	23874772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	12007018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17377214, 17652833, 21445698, 23630447, 31652395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	26184414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10379790, 10839301, 10949987, 11071457, 12505329, 14685825, 1677434, 17177989, 20510207, 21479360, 22931984, 23744557, 23788753, 24335094, 25455500 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17112805, 23816407, 24328528, 28378058, 29397568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17112805, 19558216, 20578904, 23056288, 23816407, 24328528, 28378058, 29397568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32702814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33232268, 34563206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17112805, 21183151, 23816407, 23874772, 24328528, 28378058, 29397568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	26823873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24717943, 27577924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10439313, 15102868, 15236169, 15505619, 15685540, 16305727, 16374256, 16434479, 16917230, 17255827, 17260353, 17262810, 17665184, 18819034, 19107781 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	14610718, 22661185, 23537364, 24395888, 24838898, 28759738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16374256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	7509719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10419815, 12070134, 1375156, 15964250, 18230544, 18511651, 18576903, 7914197, 9239684, 9344878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	12070134, 15964250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	12070134, 1375156, 15964250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29135105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21350189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	24918524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31064831, 31269278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	35256320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17142980, 18215618, 20555295, 20859246, 21955855, 23356581, 23880209, 24577069, 25487678, 26664259, 27918249, 29754150, 31120287		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	17142980, 21955855, 21999196, 23356581, 32015454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20859246, 21955855, 23880209, 24577069, 25600802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	36698099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36698099	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31512001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29621269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22558111	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25815791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29621269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29621269, 33053111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32762489, 33072207, 36734157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22558111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22837373, 28206854, 31269743		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28503421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	17534875, 19349543, 23828747, 25410489, 25691056, 32354939, 40282412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	31225627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17179223, 23088763, 23339364, 23829278, 25379720, 26211578, 26286835, 28339079, 30165192, 9607591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	21325069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31176774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	28146436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	18644389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	21781437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17700364, 23073467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	23073467, 34563206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31512001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	17938643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16047355, 17300681, 24100466, 8847137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	14675353, 1707232, 17300681, 36965280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17300681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30874957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20406235, 31311995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	25223475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	25223475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	11879359, 12558585, 12686700, 15473912, 16386926, 16542858, 18329296, 19453704, 20064729, 21079659, 21316268, 21388909, 21530324, 21636342, 22033938 View all (9 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	12686700, 12699350, 15679503, 15857428, 16120487, 16386926, 16542858, 16753003, 16857572, 17460550, 17521963, 17661727, 17917461, 17924830, 18329296 View all (58 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	LHGDN	12686700, 14984901, 17521963, 17917461, 17924830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	19570321, 8001500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	22606322	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	18329296, 21079659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	35430998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	19570321, 8001500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	18329296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	15452305, 16499746, 24590840, 25458099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	15452305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	31284159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	9430558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10680335, 17913048, 1973872, 23423781, 23917080, 29456815, 7509719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12089380, 25712147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	20826260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	24898446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16702732, 19960259, 21332314, 22545578, 27941276, 28441715, 8052486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16702732, 19960259, 21332314, 22545578, 27941276, 8052486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16702732, 23721345, 27941276	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21332314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16702732, 26768616, 26823755, 27941276, 30865384, 32611208, 33709789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	19197249, 24522199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	24522199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	15913990, 27287205, 7903154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	1346632, 16049968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	22515119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	20563569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	7578409, 9209454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	22239287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	25062490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	1976136, 8601564, 8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	17482840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	8625237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	15138130, 28492560, 31272718, 9893638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	14669341, 28492560, 32058310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18644389, 20464493, 27611887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	27991853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	12692067, 17262809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	33035787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25333257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28927106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	16278376, 17922049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17922049, 28335376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11079620, 9885221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	22239287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	17701008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	30235719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27133047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10639573, 10805101, 11391622, 11857404, 12125964, 12958161, 15051924, 15947495, 18568776, 18687982, 18946672, 19019175, 19832037, 21775090, 23326571 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10639573, 11351043, 18687982, 24380367, 25226230, 26447477, 28019039, 28137267, 36477472, 8883415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18568776, 18687982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10639573, 10805101, 11857404, 12958161, 15051924, 15947495, 18568776, 18687982, 18946672, 19832037, 21775090, 23326571, 23897632, 24380367, 24647572 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10589784, 10805101, 11391622, 15947495, 16193381, 1682428, 1723831, 18647494, 20952483, 2294193, 23934261, 24815474, 26883271, 28380412, 29085470 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12125964, 15015771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	14655754, 27662839, 28019039, 28534371, 31409725, 7640227, 8688320, 8780389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	22380717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	25559283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	12967327, 16584389, 19482216, 20940624, 30499912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26325438, 28807771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	8547675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	12731085, 8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20146171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	1972761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	18257092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	25346426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	16783494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11291044, 12460464, 26063766, 8797578, 9497311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	12460464, 26823873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	23874772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30212560	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	17652833, 23356581, 25164709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21445698, 23630447, 31652395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	BEFREE	23874772, 24740628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Congenital heart septal defect	Pubtator	23874772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	32871888, 33326171, 37058477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10500782, 10602414, 10695666, 12430927, 12708468, 15560070, 16038729, 16157201, 20406235, 29145976, 30597277, 30641875, 7600845, 7642463, 8105101, 9408955, 9541688, 9669392, 9834236 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21918980, 26790444, 30641875, 7565762, 9541688, 9669392, 9879641, 9885221	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	CTD_human_DG	22311042		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematological Disease	Hematological Disease	BEFREE	15203864, 21091151, 26790444, 29696003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10392899, 11156211, 21918980, 7948302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	29936693, 30742211, 33179295, 36368930, 37420302, 37641689, 39459499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32871888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	27999186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23109454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22166890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10427140, 12365029, 12407543, 14512701, 16020127, 28990842, 9713521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	28805879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30894541, 33167906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	23423781, 23744354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15560070, 17157997, 21762523, 25840583, 31811017, 8535196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21762523, 25840583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10823891, 26586297, 26661162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	9815963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	20504240, 28025333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	BEFREE	28025333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22120734, 23677857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	40532247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	16002074, 16722833, 25084202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28727815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23107763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	20166790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16138223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16002074, 25084202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	26560472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	28806349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	28806349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	32198935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23161145, 27338075, 27649668, 28792917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19290795, 20030680, 23926124, 25141899, 26830973, 27338075, 27649668, 28656587, 28792917, 30288082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	17891478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	LHGDN	17891478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocalcemia	Hypocalcemia	Pubtator	40282412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	30526541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	25982326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	27338075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	21999196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14647149, 18385176, 24901645, 26846577, 28509582, 29305422, 34181359, 36265170	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27604859, 29898734, 36748372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	10785593, 24145283, 29689707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	25559283, 26154535, 27719329, 28614261, 31305689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29572341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31419911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	29262351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	18514101, 24486577, 27258931, 30499912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29132227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25815420, 29325450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	22033938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	19815951, 26125837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	19815951, 26125837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 13	Inflammatory Bowel Disease	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10648456, 12505329, 12967327, 14610718, 15102868, 15505619, 16374256, 16434479, 16494108, 16633048, 16773678, 16990202, 17100974, 17242936, 17255827 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	14610718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	14610718, 15486347, 19115152, 22661185, 23537364, 23828747, 24838898, 25755800, 29543864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	25755800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	1680366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	16280093, 18215431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	14723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	18549893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	19879256, 23280016, 25062490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	23537364, 25346426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	30742211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	12364568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22810051, 25997249, 27233747, 30742211, 31298164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	22859359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	24586633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	18713069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25840583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17043887, 17376299		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	33785019	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	24469730, 28689442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17700595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17376299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	12089380, 14752243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	1684451, 2481665, 32876994, 34915026	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	40168071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	29483928, 36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	LHGDN	17922049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	17922049, 36344048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10070877, 10342576, 10360380, 10360822, 10362143, 10500781, 10581184, 10695666, 10914552, 11185984, 11734301, 11774737, 11976833, 12609962, 1380280 View all (75 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11170105, 12139246, 12486126, 12525496, 15351976, 16051742, 16769721, 17852455, 18200595, 18249061, 18271955, 18723777, 19414348, 19635183, 20209646 View all (19 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15351976, 16138358, 16566920, 16614510, 18059532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21677772, 24621983, 2891711, 3481435, 7949184, 8676093, 9516145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233413, 10361105, 10419902, 10651723, 10779437, 11122104, 11154229, 11313277, 11369657, 11493443, 12525496, 1370388, 15661399, 15994288, 16138358 View all (53 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1355660	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10651729, 10792272, 16258264, 7622426, 8555497, 9516145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10050716, 10214864, 10233413, 10360380, 10361105, 10374860, 10400187, 10419902, 10420992, 10500774, 10500779, 10500780, 10500792, 10500834, 10602414 View all (163 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12208746, 12389613, 12408767, 12604403, 15234575, 15339676, 16278398, 16566920, 16704962, 17112800, 17688368, 18200595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11426620, 1978691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	16950614, 18294295, 18628469, 19332043, 19349543, 21327421, 21706123, 21878834, 22271208, 24704000, 24982363, 25007187, 2573831, 25989890, 26244574 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24247158, 28782465, 9731886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	23047249, 25576094, 8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	20197395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10427140, 10551471, 11057761, 11354286, 11579388, 11905510, 11960367, 12297834, 12428063, 12514119, 12623109, 12854138, 15112342, 15453640, 15765123 View all (82 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16521213, 16733848, 17255262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	17510421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27543206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37641689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	14526408, 23401306, 25921280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30639310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29559914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11057761, 11960367, 12514119, 16237754, 16930294, 16996216, 20437864, 22363234, 29222397, 7473127, 7908989, 8102093, 8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	15936020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	15936020, 24676670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10375741, 10565770, 11585860, 14610319, 17120199, 19107762, 19484794, 22179563, 23443122, 25122423, 25563194, 25988710, 26098947, 26219569, 27995666 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1309222, 1353703, 30266280, 7915180, 7915508, 8095859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17120199, 17409824, 17851225, 19107762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15934077, 18451510, 18820766, 35757721, 37950194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10773967, 17290357, 18214345, 18820766, 21847519, 24469730, 25712147, 28154898, 28243944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22380717, 24548980, 31685786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	1766262, 7961124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11305953, 20217131, 24884960, 28362720, 36799490, 8749949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25964055	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11801309, 15102684, 24142546, 7910222, 8075575, 8535665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10340550, 10766353, 11205285, 11755462, 12017290, 1352183, 15161039, 15725475, 16093797, 16277030, 17634410, 1766262, 19414348, 20393003, 21509569 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16277030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16309213, 17634410, 19414348, 21918980, 2572270, 27564097, 7632959, 9160686, 9473242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29368155, 29761078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	23339364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	8535196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	1674435, 17157997, 17454628, 2323839, 24053936, 24756092, 25769453, 7765326, 8094105, 8535196, 9722297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17157997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	1674435, 17157997, 17454628, 2323839, 24756092, 7765326, 8094105, 8535196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23532732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	26153782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	9722297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17913323, 18550244, 20859246, 22306099, 22641028, 23188198, 24200053, 24911075, 25815420, 25847751, 27309038, 28079463, 31634334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22641028, 23273899, 24200053, 24911075, 25815420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	12558585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	7833115, 7904171, 8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10805101, 16193381, 7790119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11291044, 12460464, 26063766, 8797578, 9497311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11697834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	1675220, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21827403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10092063, 10369069, 10381498, 10597187, 10960771, 11391630, 11803466, 12174911, 12467215, 12533839, 1359153, 14967819, 15015586, 15034303, 15102684 View all (215 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17300681, 24100466, 8847137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16702732, 19960259, 21332314, 22545578, 27941276, 8052486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21332314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	15138130, 28492560, 9893638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	1735085, 20699370, 25333257, 26328486, 31563593, 8637212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	16788565, 20840328, 22358302, 3681376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11960367, 15112342, 23925649, 24647772, 26261589, 30066890, 30982500, 31420991, 31679697, 31704064, 8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10048981, 10357555, 11305953, 11724293, 11745426, 1309222, 1374598, 16087181, 17120199, 17259654, 17409824, 18656688, 19107762, 19484794, 1974823 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24247158, 28782465, 30352381, 9731886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10656626, 11780384, 11863219, 1359152, 16288028, 16467099, 16803472, 1682037, 17001177, 17143487, 17828752, 18765553, 19040611, 1973872, 20624637 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11039467, 15138133, 22099584, 23263160, 24288256, 8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11078791, 15026333, 15042610, 15161039, 15342374, 16166436, 18242387, 19401306, 21480311, 21700680, 23861346, 23906293, 24085442, 24344919, 24853766 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15999103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10446694, 11205224, 15756676, 1735085, 17608636, 17944563, 18644389, 19331170, 19956892, 20636108, 20843132, 22641402, 23801278, 23893241, 24116826 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11156211, 20689757, 21292509, 21935574, 22986993, 24601223, 26657501, 26717965, 28676933, 28714514, 30349370, 30967374, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10070941, 10321019, 10399951, 10427140, 10430060, 10491523, 10500775, 10500782, 10589744, 10709112, 10745175, 10918491, 11205224, 11205285, 11475537 View all (353 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22269388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	15609299, 24040940, 8727096, 9216701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	17374987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22245869, 28447725, 31424649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10399951, 11052631, 12370750, 1355483, 15742416, 15912392, 1671638, 1681110, 1682280, 17003290, 1735085, 17674045, 18644389, 18673531, 19192650 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10092063, 11501838, 12576456, 15102684, 19047049, 1970934, 19807929, 23280016, 23481629, 2466554, 24736530, 24886669, 26708059, 28212576, 28670140 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12174914, 12576456, 12684679, 15498565, 16773437, 17033200, 17560460, 17955490, 18095031, 18200595, 18300948, 18654608, 19001875, 19129072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	22311042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	14583799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29695404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7756676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10894369, 18473730, 18946672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	24887326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10692111, 11298532, 11525950, 16034303, 17943188, 21718179, 24098529, 7960246, 9635679		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	11286621, 15009716, 15999103, 17943188, 18604175, 25300205, 28293855, 7495278, 8976731	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	16141933, 17943188, 18279661		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	11391622, 12125964, 1682428, 26315299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	14723263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17142980, 18215618, 20555295, 20859246, 21955855, 23356581, 23880209, 24577069, 25487678, 26664259, 27918249, 31120287		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20859246, 21955855, 23880209, 24577069, 25600802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	CTD_human_DG	17015054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28502879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	CTD_human_DG	17015054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	24586633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	7910154, 9495245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	11697834, 18385176, 26004871, 29261027, 30423827, 30689265, 7925305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30787874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30787874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27288795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15020609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	23682680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31126216		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31659146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17142980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	17142980, 29668471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	12073053, 34092610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	35727214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	24013781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	28727815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10088973, 10809991, 12180485, 15739024, 16929535, 17488488, 18408561, 18639335, 19373654, 19639185, 20532504, 21705081, 22434582, 23475625, 23589314 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	1348425, 1676918, 16929535, 17488488, 20532504, 22434582, 23475625, 23589314, 24400589, 2568864, 26790444, 27039718, 28509582, 29177954, 30079960 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16929535, 17488488, 18408561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30717494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33037101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	18717915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	18717915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	10500774, 23684483, 8100604		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10374424, 10500774, 10500778, 10695666, 15020609, 16566920, 23684483, 7536492, 7901457, 7915092, 8011551, 8100604		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	16566920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15020609, 23684483, 9734653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	8105147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12010657, 1773788, 18938236, 1972622, 21677772, 24142546, 2575610, 28487651, 3481435, 8704189, 8766251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12010657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12609962, 16001089, 16157201, 18524988, 1972761, 1976871, 20147974, 20204543, 20206383, 20499132, 21311410, 21520403, 21567097, 21718141, 22134106 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	18524988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	16001089, 9746764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18622260, 19106083, 19784880, 20712525, 22190063, 23364775, 24328528, 25118983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20801494, 35473443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	25118983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsy Juvenile	Myoclonic epilepsy	Pubtator	24586633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	26438079, 28350522, 29589533, 31298164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	26757307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24717943, 27577924, 30874957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	18756548, 23768637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24340057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25900553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	25340731, 27883323, 29546524, 33794950, 40282412	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	11794258, 1679995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037101, 10190320, 10198619, 10210147, 10365134, 10379790, 10425316, 10427140, 10446694, 10463770, 10466525, 10473106, 10491523, 10581184, 10589744 View all (377 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22269388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	2224796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10392899, 11734301, 1358618, 14962262, 20187302, 20423567, 24413370, 7591203, 9127318		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	26560472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	25559283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	15934077, 29615122, 33785019, 34603785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	16761159, 21460357, 21525574, 21553324, 23994685, 29615122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	25559283, 26154535, 27719329, 28614261, 31305689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	16950614, 18628469	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	12360103, 27354093		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	CTD_human_DG	17015054, 21064136		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	23684483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	11391622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10376971, 12885402, 16547352, 1678252, 1679995, 1682809, 22088485, 25111243, 2573830, 27517323, 34465595, 9818076	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	10536185, 11172599, 11474132, 12078865, 12125964, 12960142, 1348013, 1374683, 1678252, 17387584, 18713069, 1974410, 21317832, 2185879, 22088485 View all (19 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	LHGDN	17387584		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	8761367		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22837672, 25218792, 35256320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18265929, 19949924, 27158936, 30429967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10894369, 1346632, 1348013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	12125964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	16950614, 18628469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	16950614, 18294295, 18628469, 19349543, 21327421, 22271208, 24704000, 24982363, 25007187, 25989890, 26244574, 27269636, 27701910, 27845419, 28817838, 31123858 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	CTD_human_DG	16950614, 25007187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	16950614, 17534875, 18628469, 19470925, 25340731, 25410489, 26244574, 27845419, 28036387, 28817838, 32778670, 33955129, 39596349	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	10622400		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Ulcerative colitis	Ulcerative colitis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12239453, 12926120, 1374598, 15277258, 15802814, 15856298, 16572896, 17593626, 17851225, 18812689, 19875192, 19900859, 20189873, 20627363, 21827803 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	20627363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20563569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18442890, 26084465, 28218636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18442890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26084465	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	23244145, 29885788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19282465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10321019, 10500782, 10597187, 10697541, 10894867, 11595696, 11853886, 12533839, 12695554, 15547696, 15913990, 16049968, 17045162, 17279585, 17703109 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11294418, 11794258, 12695554, 15112275, 16602111, 22016816, 24083708, 24841650, 24996541, 26300407, 26408180, 26603906, 26790551, 27287205, 30430199 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	12473588, 31029905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11780384, 11863219, 19040611, 23542236, 2565764, 31173253, 31416138, 9216679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27060927		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	1359152, 16288028, 16467099, 16803472, 1682037, 17001177, 17113177, 17143487, 17828752, 18063021, 18765553, 1973872, 20624637, 20944127, 21618519 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16382445, 17062699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16401397, 17459055, 17611393, 17828752, 18765553, 19040611, 19401306, 19516889, 20540746, 21618519, 21955855, 22792399, 23098446, 23174937, 23542236 View all (32 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	22924580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11039467, 15138133, 20335952, 22099584, 22367292, 23263160, 24288256, 8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29287249, 8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17695494, 20922799, 25036383, 28099906, 29550476, 32924881, 33053111, 37108495, 37857015, 38163893, 8605092, 8766529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	11929704, 17299072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paresthesia	Paresthesia	Pubtator	34463270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12360103, 12724617, 15542248, 15767512, 18265929, 18325822, 18855017, 19184162, 19196542, 19255821, 19663741, 20558393, 22971641, 23987116, 24572589 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	12360103, 12724617, 15767512		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	20558393		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	22971641, 26457621	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	12360103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease, Secondary Vascular	Parkinson Disease	CTD_human_DG	26457621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	12724617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	29948283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	11912009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18644389, 22001987, 22087845, 24815441, 27611887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	22001987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	27464309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	27464309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	16950614, 25084203, 28447211, 8815917		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	16950614		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	16950614, 18628469	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	16950614, 25084203, 28447211, 8815917		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peroxisome Biogenesis Disorder, Complementation Group D	Zellweger Syndrome	BEFREE	8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	20166790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	1974900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	17429576, 18946672, 28137267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	16953066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	16953066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	30240697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15235109, 7694687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11323101, 11801309, 11964305, 12028995, 12410571, 1283551, 12851703, 15102684, 15543372, 16206189, 16849280, 19317599, 23244145, 24142546, 27960630 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12130511, 15059065, 15547738, 15717687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18385752, 20423567, 25697355, 31043590, 7694687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31064831, 31269278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12763363, 15690482, 16584389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	15700834, 1682428, 30729282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	BEFREE	1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	22112610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17100974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive intrahepatic cholestasis (disorder)	Intrahepatic Cholestasis	BEFREE	18049123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	9430558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11078791, 15026333, 15042610, 15161039, 15342374, 16166436, 18242387, 19401306, 21480311, 21700680, 23861346, 23906293, 24085442, 24344919, 24853766 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	24344919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10629088, 11279018, 11909640, 15042610, 16083877, 1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17440963	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18076941, 18628469, 20053773, 20649571, 21694441, 23861346, 24344919, 26459268, 34326198, 36602227, 36614114, 37796964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18628469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	36952646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24889923, 31512001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20563569		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	24918524		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21243282, 23731729, 29791609, 33072207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	9360432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31419911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28347333, 9935221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	24734954, 7580102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	16788565, 20840328, 22358302, 3681376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10365134, 10379790, 10839301, 10949987, 11071457, 12017273, 12505329, 14685825, 1677434, 16788565, 17177989, 20510207, 21479360, 22931984, 23744557 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17177989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25521359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	18408564, 20030680, 20061922, 23107770, 28689442, 29028125, 30719631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28730106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15548804, 25173639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	1682862, 20190417, 25173639, 27816545, 30225219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	10470293, 14654923, 15015604, 16652192, 9455797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	10470293	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	15015604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	18377424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	10470293, 18377424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10773966, 16932953, 17181924, 17466917, 20080907, 21947347, 22235146, 23095111, 24734954, 25817604, 26071279, 26652611, 28299396, 28696805, 29670920, 30209762, 31127007, 31376257, 7580102 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20080907, 22104130		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	10473106, 10491523, 12112526, 12426490, 1606072, 16230402, 1859877, 7803538, 7903154, 7904171, 8695249, 8727096, 8862015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	12112526		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	15563462, 17692467, 27683125, 29689707, 7903154, 8664189, 9038218, 9298839	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	37731501, 7903154, 8093700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	21829205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	17464317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	27683125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	20060871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16386826, 17038883, 17054409, 17113599, 17142980, 18543120, 20060871, 20143052, 20195292, 20563569, 20620031, 21148022, 22909202, 22910404, 23609388 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	17142980, 18718676, 24918524, 29668471	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22910404, 23609388, 24682161, 24918524		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	21142916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	24861996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	28534442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	10500777, 12010657, 1283551, 7808005, 8628017, 9129038, 9408958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	19862647, 29499902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Parkinson Disease	Parkinson disease	CTD_human_DG	26457621		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	18329296, 19453704, 22606322, 23717663, 32054883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	28447211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30124547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	30097905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	28325287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	23152970, 23356581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	7961124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34386009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24898446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	20030680, 8099135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	22672924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10100721, 10360828, 10815935, 11821018, 12712436, 1348921, 16478794, 1684906, 16934363, 17667922, 20047843, 21163134, 22543673, 2571355, 7697632 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	11822755, 14610319, 17327908, 17667922, 2571355, 27367030, 32114419, 8104371, 8213218, 9652763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	8601564, 9669390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	22033938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	BEFREE	1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic Neoplasms	BEFREE	9062390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	28151874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17549370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11291044, 1374598, 15375553, 17374987, 1970934, 28340578, 30352381, 7669560, 9731886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15197778, 19264847, 26768616, 26823755, 27941276, 28669726, 29107111, 29340044, 30865384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12073053, 15113040, 22180460, 22276165, 25275603, 29171106, 33134377	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25379720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10744048, 22180460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	25275603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	8523980		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	25217066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28195743, 28627626, 29380527, 30279018, 31061316, 31379495, 31638830, 31661303, 31706919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	21460357, 21974705, 31191307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	10785593, 24145283, 29689707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	17043887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	24861996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10446694, 10896996, 11205224, 12530067, 14752223, 15375376, 15649014, 15756676, 1735085, 17608636, 17944563, 18644389, 19331170, 19956892, 20636108 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10446694, 12071854, 12085207, 14726695, 15040019, 15771954, 15875780, 16340247, 16410721, 17952118, 18673531, 19091131, 19143835, 19331170, 19638344 View all (29 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16410721, 17608636, 18058465, 18673531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	2575610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26084465	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	23244145, 28381801, 29885788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	23244145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18622260, 20801494, 30742211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12533839, 17464317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28534442		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17634410, 28606042, 30020405, 30972167, 31810914		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	18756548		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	1972761		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	8648821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	39258697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	30212560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25340731, 25881102, 33326171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	32899083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15711177, 15750166, 23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34360846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20844484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15750166, 23803106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	17529887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	31770573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	24861996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30742211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29179467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	15886424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25140317, 26767845, 27813130, 28624192, 28750689, 29323124, 29750424, 30362543, 30482226, 30926829, 31222559, 31742868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26767845, 27527855, 27813130, 31742868, 32471192, 36291159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	10580886, 14749549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	14984901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10439313, 12512026, 1353719, 15102868, 15236169, 15505619, 15685540, 16305727, 16374256, 16434479, 16462040, 16633048, 17206635, 17242936, 17255827 View all (22 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	12512026, 15102868, 15685540, 16374256, 16434479, 16462040, 16773678, 17665184, 17828778, 19005421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	21332314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17913323, 18550244, 20859246, 22306099, 22641028, 23188198, 24200053, 24911075, 25815420, 25847751, 27309038, 28079463, 31634334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22641028, 23273899, 24200053, 24911075, 25815420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12884023, 1684451, 20689757, 23495258, 28560953, 32131547, 33720323, 34048174, 34270461, 35610207, 7734314, 7908215, 8567404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	1680203	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22245869, 28659181, 29151072, 31180057, 31424649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	22927901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	9635679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginitis	Vaginitis	BEFREE	16006060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Variegate Porphyria	Variegate Porphyria	BEFREE	7960246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Right	Ventricular dysfunction	Pubtator	29791609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	22033938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	7965510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	9797872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	20811663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group B	Xeroderma Pigmentosum	BEFREE	11077043		★★★★★ ★☆☆☆☆ Found in Text Mining only

ABCB1 (ATP binding cassette subfamily B member 1)