Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	51166
Gene name	Aminoadipate aminotransferase
Gene symbol	AADAT
Synonyms (NCBI Gene)	KAT2KATIIKYAT2
Chromosome	4
Chromosome location	4q33
Summary	This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccarop

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027084	hsa-miR-103a-3p	Sequencing	20371350
MIRT031647	hsa-miR-16-5p	Sequencing	20371350
MIRT756750	hsa-miR-1224-5p	CLIP-seq
MIRT756751	hsa-miR-129-5p	CLIP-seq
MIRT756752	hsa-miR-1303	CLIP-seq
MIRT756753	hsa-miR-1304	CLIP-seq
MIRT756754	hsa-miR-1972	CLIP-seq
MIRT756755	hsa-miR-3187-3p	CLIP-seq
MIRT756756	hsa-miR-340	CLIP-seq
MIRT756757	hsa-miR-3650	CLIP-seq
MIRT756758	hsa-miR-3653	CLIP-seq
MIRT756759	hsa-miR-3658	CLIP-seq
MIRT756760	hsa-miR-3915	CLIP-seq
MIRT756761	hsa-miR-3928	CLIP-seq
MIRT756762	hsa-miR-4307	CLIP-seq
MIRT756763	hsa-miR-4435	CLIP-seq
MIRT756764	hsa-miR-4502	CLIP-seq
MIRT756765	hsa-miR-450b-5p	CLIP-seq
MIRT756766	hsa-miR-4529-5p	CLIP-seq
MIRT756767	hsa-miR-4689	CLIP-seq
MIRT756768	hsa-miR-4701-5p	CLIP-seq
MIRT756769	hsa-miR-507	CLIP-seq
MIRT756770	hsa-miR-548s	CLIP-seq
MIRT756771	hsa-miR-557	CLIP-seq
MIRT756772	hsa-miR-582-5p	CLIP-seq
MIRT756773	hsa-miR-588	CLIP-seq
MIRT756774	hsa-miR-590-3p	CLIP-seq
MIRT756775	hsa-miR-759	CLIP-seq
MIRT756776	hsa-miR-877	CLIP-seq
MIRT756777	hsa-miR-103a	CLIP-seq
MIRT756778	hsa-miR-107	CLIP-seq
MIRT756779	hsa-miR-1184	CLIP-seq
MIRT756780	hsa-miR-1206	CLIP-seq
MIRT756781	hsa-miR-1245	CLIP-seq
MIRT756782	hsa-miR-1264	CLIP-seq
MIRT756783	hsa-miR-1297	CLIP-seq
MIRT756784	hsa-miR-1343	CLIP-seq
MIRT756785	hsa-miR-1470	CLIP-seq
MIRT756786	hsa-miR-15a	CLIP-seq
MIRT756787	hsa-miR-15b	CLIP-seq
MIRT756788	hsa-miR-16	CLIP-seq
MIRT756789	hsa-miR-195	CLIP-seq
MIRT756790	hsa-miR-199a-5p	CLIP-seq
MIRT756791	hsa-miR-199b-5p	CLIP-seq
MIRT756792	hsa-miR-21	CLIP-seq
MIRT756793	hsa-miR-216a	CLIP-seq
MIRT756794	hsa-miR-217	CLIP-seq
MIRT756795	hsa-miR-26a	CLIP-seq
MIRT756796	hsa-miR-26b	CLIP-seq
MIRT756797	hsa-miR-3148	CLIP-seq
MIRT756798	hsa-miR-3682-5p	CLIP-seq
MIRT756799	hsa-miR-371-5p	CLIP-seq
MIRT756800	hsa-miR-371b-5p	CLIP-seq
MIRT756801	hsa-miR-424	CLIP-seq
MIRT756802	hsa-miR-4255	CLIP-seq
MIRT756803	hsa-miR-4418	CLIP-seq
MIRT756804	hsa-miR-4452	CLIP-seq
MIRT756805	hsa-miR-4465	CLIP-seq
MIRT756806	hsa-miR-4468	CLIP-seq
MIRT756807	hsa-miR-4469	CLIP-seq
MIRT756808	hsa-miR-4659a-3p	CLIP-seq
MIRT756809	hsa-miR-4659b-3p	CLIP-seq
MIRT756810	hsa-miR-4667-3p	CLIP-seq
MIRT756811	hsa-miR-4668-3p	CLIP-seq
MIRT756812	hsa-miR-497	CLIP-seq
MIRT756813	hsa-miR-509-3-5p	CLIP-seq
MIRT756814	hsa-miR-509-5p	CLIP-seq
MIRT756815	hsa-miR-548c-3p	CLIP-seq
MIRT756816	hsa-miR-579	CLIP-seq
MIRT756817	hsa-miR-590-5p	CLIP-seq
MIRT756779	hsa-miR-1184	CLIP-seq
MIRT756792	hsa-miR-21	CLIP-seq
MIRT756794	hsa-miR-217	CLIP-seq
MIRT756757	hsa-miR-3650	CLIP-seq
MIRT756803	hsa-miR-4418	CLIP-seq
MIRT756813	hsa-miR-509-3-5p	CLIP-seq
MIRT756814	hsa-miR-509-5p	CLIP-seq
MIRT756817	hsa-miR-590-5p	CLIP-seq
MIRT756792	hsa-miR-21	CLIP-seq
MIRT756817	hsa-miR-590-5p	CLIP-seq
MIRT2442881	hsa-miR-1197	CLIP-seq
MIRT2442882	hsa-miR-3545-3p	CLIP-seq
MIRT2442883	hsa-miR-606	CLIP-seq
MIRT2442881	hsa-miR-1197	CLIP-seq
MIRT2442882	hsa-miR-3545-3p	CLIP-seq
MIRT2442883	hsa-miR-606	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006103	Process	2-oxoglutarate metabolic process	IDA	18620547
GO:0006536	Process	Glutamate metabolic process	IDA	18620547
GO:0008483	Function	Transaminase activity	IEA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IBA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IDA	18620547
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0033512	Process	L-lysine catabolic process to acetyl-CoA via saccharopine	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	18620547
GO:0047315	Function	Kynurenine-glyoxylate transaminase activity	IDA	18620547
GO:0047315	Function	Kynurenine-glyoxylate transaminase activity	IEA
GO:0047536	Function	2-aminoadipate transaminase activity	IDA	18620547
GO:0047536	Function	2-aminoadipate transaminase activity	IEA
GO:0047958	Function	Glycine:2-oxoglutarate aminotransferase activity	IDA	18620547
GO:0047958	Function	Glycine:2-oxoglutarate aminotransferase activity	IEA
GO:0050094	Function	Methionine-glyoxylate transaminase activity	IDA	18620547
GO:0050094	Function	Methionine-glyoxylate transaminase activity	IEA
GO:0070189	Process	Kynurenine metabolic process	IDA	18620547
GO:1901605	Process	Alpha-amino acid metabolic process	IBA

MIM	HGNC	e!Ensembl
611754	17929	ENSG00000109576

Q8N5Z0

Protein name

Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (KAT/AadAT) (2-aminoadipate aminotransferase) (2-aminoadipate transaminase) (EC 2.6.1.39) (Alpha-aminoadipate aminotransferase) (AadAT) (Glycine transaminase AADAT) (EC 2.6.1.4) (Kynurenine ami

Protein function

Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino

PDB

2QLR , 2R2N , 2VGZ , 2XH1 , 3DC1 , 3UE8 , 4GDY , 4GE4 , 4GE7 , 4GE9 , 4GEB , 5EFS , 5EUN , 5TF5 , 6D0A , 6T8P , 6T8Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00155	Aminotran_1_2	43 → 417	Aminotransferase class I and II	Domain

Tissue specificity

TISSUE SPECIFICITY: Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.

Sequence

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL

Sequence length

425

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety disorder	Pubtator	27072370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33767242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29366832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38115320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31666808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29777939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Detrusor and sphincter dyssynergia	Detrusor And Sphincter Dyssynergia	BEFREE	27391207, 27995942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10441733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35715314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29777939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26773745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37410216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22350071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17594596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31308447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	27391207, 27995942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37328804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31666808		★★★★★ ★☆☆☆☆ Found in Text Mining only

AADAT (aminoadipate aminotransferase)