A4GNT (alpha-1,4-N-acetylglucosaminyltransferase)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 51146
• Gene name: Alpha-1,4-N-acetylglucosaminyltransferase
• Gene symbol: A4GNT
• Synonyms (NCBI Gene): alpha4GnT
• Chromosome: 3
• Chromosome location: 3q22.3
• Summary: This gene encodes a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Go

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756643	hsa-miR-4436a	CLIP-seq
MIRT756644	hsa-miR-4698	CLIP-seq
MIRT756645	hsa-miR-4759	CLIP-seq
MIRT2164666	hsa-miR-4264	CLIP-seq
MIRT2164667	hsa-miR-4704-3p	CLIP-seq
MIRT2164668	hsa-miR-4777-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	10430883
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	TAS	10430883
GO:0008375	Function	Acetylglucosaminyltransferase activity	IBA
GO:0008375	Function	Acetylglucosaminyltransferase activity	IDA	10430883
GO:0008375	Function	Acetylglucosaminyltransferase activity	IEA
GO:0008375	Function	Acetylglucosaminyltransferase activity	TAS	10430883
GO:0009101	Process	Glycoprotein biosynthetic process	IDA	10430883
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10430883
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016758	Function	Hexosyltransferase activity	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA

Other IDs

• MIM: 616709
• HGNC: 17968
• e!Ensembl: ENSG00000118017

Protein

• UniProt ID: Q9UNA3
• Protein name: Alpha-1,4-N-acetylglucosaminyltransferase (Alpha4GnT) (EC 2.4.1.-)
• Protein function: Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans (PubMed:10430883). Necessary for the synthesis of type III mucin which is specifically produced in the stomach, duodenum, and pancreatic duct (PubMed:10430883).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04488	Gly_transf_sug	64 → 188	Glycosyltransferase sugar-binding region containing DXD motif	Family
  PF04572	Gb3_synth	196 → 323	Alpha 1,4-glycosyltransferase conserved region	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in stomach and pancreas. {ECO:0000269|PubMed:10430883}.
• Sequence:

  MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSER
  MEPPHLVSCSVESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLD
  MKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEEN
  FLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSAIWGNQGPELMTRMLRVWCKLED
  FQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
  IRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK

• Sequence length: 340

Pathways

Reactome Pathway:

O-linked glycosylation of mucins

Related Genes

No strongly related genes found yet for A4GNT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to A4GNT.