Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9986
Gene name	Ras converting CAAX endopeptidase 1
Gene symbol	RCE1
Synonyms (NCBI Gene)	FACE2RCE1ARCE1B
Chromosome	11
Chromosome location	11q13.2
Summary	This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030395	hsa-miR-24-3p	Microarray	19748357
MIRT042110	hsa-miR-484	CLASH	23622248
MIRT038128	hsa-miR-423-5p	CLASH	23622248
MIRT459207	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT459206	hsa-miR-4259	PAR-CLIP	23592263
MIRT459205	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459204	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT459203	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT459202	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT459200	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT459201	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT459199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT459198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT459197	hsa-miR-4651	PAR-CLIP	23592263
MIRT459196	hsa-miR-608	PAR-CLIP	23592263
MIRT459195	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT459194	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT459193	hsa-miR-4447	PAR-CLIP	23592263
MIRT459192	hsa-miR-4472	PAR-CLIP	23592263
MIRT459191	hsa-miR-1275	PAR-CLIP	23592263
MIRT459190	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT459188	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT459189	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT459187	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT459207	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT459206	hsa-miR-4259	PAR-CLIP	23592263
MIRT459205	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459204	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT459203	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT459202	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT459200	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT459201	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT459199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT459198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT459197	hsa-miR-4651	PAR-CLIP	23592263
MIRT459196	hsa-miR-608	PAR-CLIP	23592263
MIRT459195	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT459194	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT459193	hsa-miR-4447	PAR-CLIP	23592263
MIRT459192	hsa-miR-4472	PAR-CLIP	23592263
MIRT459191	hsa-miR-1275	PAR-CLIP	23592263
MIRT459190	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT459188	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT459189	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT459187	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1298224	hsa-miR-1827	CLIP-seq
MIRT1298225	hsa-miR-2467-3p	CLIP-seq
MIRT1298226	hsa-miR-3942-3p	CLIP-seq
MIRT1298227	hsa-miR-4257	CLIP-seq
MIRT1298228	hsa-miR-646	CLIP-seq
MIRT2088681	hsa-miR-1200	CLIP-seq
MIRT2088682	hsa-miR-1283	CLIP-seq
MIRT2088683	hsa-miR-4324	CLIP-seq
MIRT2088684	hsa-miR-491-5p	CLIP-seq
MIRT2088685	hsa-miR-544b	CLIP-seq
MIRT2313536	hsa-miR-103b	CLIP-seq
MIRT2313537	hsa-miR-3150a-3p	CLIP-seq
MIRT2313538	hsa-miR-3175	CLIP-seq
MIRT2313539	hsa-miR-376a	CLIP-seq
MIRT2313540	hsa-miR-376b	CLIP-seq
MIRT2313541	hsa-miR-4446-3p	CLIP-seq
MIRT2313542	hsa-miR-4492	CLIP-seq
MIRT2313543	hsa-miR-4498	CLIP-seq
MIRT2313544	hsa-miR-4505	CLIP-seq
MIRT2313545	hsa-miR-4667-5p	CLIP-seq
MIRT2313546	hsa-miR-4693-3p	CLIP-seq
MIRT2313547	hsa-miR-4700-5p	CLIP-seq
MIRT2313548	hsa-miR-4721	CLIP-seq
MIRT2313549	hsa-miR-4728-5p	CLIP-seq
MIRT2313550	hsa-miR-4731-5p	CLIP-seq
MIRT2088684	hsa-miR-491-5p	CLIP-seq
MIRT2313551	hsa-miR-541	CLIP-seq
MIRT2313552	hsa-miR-654-5p	CLIP-seq
MIRT2313553	hsa-miR-762	CLIP-seq
MIRT2313554	hsa-miR-939	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004175	Function	Endopeptidase activity	IDA	19188362
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19188362
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS	10085068
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008238	Function	Exopeptidase activity	IDA	10085068
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0018342	Process	Protein prenylation	IDA	10085068
GO:0071586	Process	CAAX-box protein processing	IBA
GO:0071586	Process	CAAX-box protein processing	IDA	10085068
GO:0071586	Process	CAAX-box protein processing	IEA
GO:0071586	Process	CAAX-box protein processing	IMP	19188362
GO:0080120	Process	CAAX-box protein maturation	IEA

MIM	HGNC	e!Ensembl
605385	13721	ENSG00000173653

Q9Y256

Protein name

CAAX prenyl protease 2 (EC 3.4.26.1) (Farnesylated proteins-converting enzyme 2) (FACE-2) (Prenyl protein-specific endoprotease 2) (RCE1 homolog) (hRCE1)

Protein function

Protease involved in the processing of a variety of prenylated proteins containing the C-terminal CAAX motif, where C is a cysteine modified with an isoprenoid lipid, A is an aliphatic amino acid and X is any C-terminal amino acid. Proteolytical

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02517	CPBP	148 → 267	CPBP intramembrane metalloprotease	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10085068}.

Sequence

MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL
PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCVLLERAGDSEAPLCS

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	Terpenoid backbone biosynthesis		Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	31655058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31655058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26546252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28615075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28159979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28615075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28615075	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28159979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31655058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31506952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26546252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29424242, 31506952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28615075, 31506952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26546252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28159979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	11739732		★★★★★ ★☆☆☆☆ Found in Text Mining only

RCE1 (Ras converting CAAX endopeptidase 1)