Gene Gene information from NCBI Gene database.
Entrez ID 9978
Gene name Ring-box 1
Gene symbol RBX1
Synonyms (NCBI Gene)
BA554C12.1RNF75ROC1
Chromosome 22
Chromosome location 22q13.2
Summary This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Re
miRNA miRNA information provided by mirtarbase database.
177
miRTarBase ID miRNA Experiments Reference
MIRT049206 hsa-miR-92a-3p CLASH 23622248
MIRT054190 hsa-miR-194-5p FlowLuciferase reporter assayqRT-PCRWestern blot 25412959
MIRT054190 hsa-miR-194-5p FlowLuciferase reporter assayqRT-PCRWestern blot 25412959
MIRT719975 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT719974 hsa-miR-2276-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
141
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IDA 28890335
GO:0000082 Process G1/S transition of mitotic cell cycle IDA 25438055
GO:0000165 Process MAPK cascade TAS
GO:0000209 Process Protein polyubiquitination IDA 14528312
GO:0000423 Process Mitophagy IMP 22505714
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603814 9928 ENSG00000100387
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P62877
Protein name E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-term
Protein function E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progre
PDB 1LDJ , 1LDK , 1U6G , 2HYE , 2LGV , 3DPL , 3DQV , 3RTR , 4F52 , 4P5O , 5N4W , 6R6H , 6R7F , 6R7H , 6R7I , 6R7N , 6TTU , 7B5L , 7B5M , 7B5N , 7B5S , 7OKQ , 7PLO , 7Z8B , 7Z8R , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8B3G , 8B3I , 8CDJ , 8CDK , 8GQ6 , 8H33 , 8H34 , 8H35 , 8H36 , 8H37 , 8H38 , 8H3A , 8H3F , 8H3Q , 8H3R , 8IJ1 , 8JAQ , 8JAS , 8JAV , 8JE1 , 8K9I , 8KHP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12678 zf-rbx1 40 98 RING-H2 zinc finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed.
Sequence
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN
REWEFQKYGH
Sequence length 108
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Nucleotide excision repair
HIF-1 signaling pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Shigellosis
Human immunodeficiency virus 1 infection
Pathways in cancer
Renal cell carcinoma
  Recognition of DNA damage by PCNA-containing replication complex
Prolactin receptor signaling
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Vif-mediated degradation of APOBEC3G
Degradation of beta-catenin by the destruction complex
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Degradation of DVL
Degradation of GLI1 by the proteasome
GLI3 is processed to GLI3R by the proteasome
Hedgehog 'on' state
Regulation of RAS by GAPs
DNA Damage Recognition in GG-NER
Formation of Incision Complex in GG-NER
Dual Incision in GG-NER
Formation of TC-NER Pre-Incision Complex
Transcription-Coupled Nucleotide Excision Repair (TC-NER)
Dual incision in TC-NER
Gap-filling DNA repair synthesis and ligation in TC-NER
Orc1 removal from chromatin
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
Regulation of RUNX2 expression and activity
Neddylation
Interleukin-1 signaling
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CROHN'S DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anxiety Anxiety Disorder GWASCAT_DG 29942085
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 23667514, 26742010
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20680678
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 28946546, 30237511 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 22935614, 25540389 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 22965024 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 23667514, 26742010
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 28946546 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 25114896
★☆☆☆☆
Found in Text Mining only
Chromosomal Instability Chromosomal instability Pubtator 33290867, 36496990 Associate
★☆☆☆☆
Found in Text Mining only