CLEC2B (C-type lectin domain family 2 member B)

Gene

• Entrez ID: 9976
• Gene name: C-type lectin domain family 2 member B
• Gene symbol: CLEC2B
• Synonyms (NCBI Gene): AICL, CLECSF2, HP10085, IFNRG1
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029245	hsa-miR-26b-5p	Microarray	19088304
MIRT895812	hsa-miR-128	CLIP-seq
MIRT895813	hsa-miR-27a	CLIP-seq
MIRT895814	hsa-miR-27b	CLIP-seq
MIRT895815	hsa-miR-4311	CLIP-seq
MIRT895816	hsa-miR-4328	CLIP-seq
MIRT895817	hsa-miR-450b-5p	CLIP-seq
MIRT895818	hsa-miR-4704-3p	CLIP-seq
MIRT895819	hsa-miR-507	CLIP-seq
MIRT895820	hsa-miR-548aa	CLIP-seq
MIRT895821	hsa-miR-557	CLIP-seq
MIRT1965629	hsa-miR-1324	CLIP-seq
MIRT1965630	hsa-miR-2052	CLIP-seq
MIRT1965631	hsa-miR-514	CLIP-seq
MIRT1965632	hsa-miR-514b-3p	CLIP-seq
MIRT2504465	hsa-miR-3163	CLIP-seq
MIRT2504466	hsa-miR-4635	CLIP-seq
MIRT2504467	hsa-miR-4775	CLIP-seq
MIRT2504468	hsa-miR-561	CLIP-seq
MIRT2504469	hsa-miR-590-3p	CLIP-seq
MIRT2678260	hsa-miR-2054	CLIP-seq
MIRT2504465	hsa-miR-3163	CLIP-seq
MIRT2678261	hsa-miR-4446-5p	CLIP-seq
MIRT2678262	hsa-miR-4474-5p	CLIP-seq
MIRT2504466	hsa-miR-4635	CLIP-seq
MIRT2678263	hsa-miR-4753-3p	CLIP-seq
MIRT2678264	hsa-miR-4755-5p	CLIP-seq
MIRT2678265	hsa-miR-633	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	23929856
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9038101
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	9038101
GO:0042802	Function	Identical protein binding	IPI	20194751
GO:0048018	Function	Receptor ligand activity	IDA	17057721
GO:0051132	Process	NK T cell activation	IDA	17057721
GO:0051132	Process	NK T cell activation	IDA	17057721

Other IDs

• MIM: 603242
• HGNC: 2053
• e!Ensembl: ENSG00000110852

Protein

• UniProt ID: Q92478
• Protein name: C-type lectin domain family 2 member B (Activation-induced C-type lectin) (C-type lectin superfamily member 2) (IFN-alpha-2b-inducing-related protein 1)
• Protein function: Membrane-bound protein expressed on myeloid cells which acts as a ligand to stimulate the activating receptor NKp80/KLRF1, expressed on the surface of natural killer (NK) cells. In turn, stimulates NK-cell cytotoxicity and cytokine production le
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	52 → 146	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed preferentially in lymphoid tissues, and in most hematopoietic cell types.
• Sequence:

  MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSK
  YNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
  EGCAYLSDDGAATARCYTERKWICRKRIH

• Sequence length: 149

Pathways

KEGG:

Kaposi sarcoma-associated herpesvirus infection

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations