Gene Gene information from NCBI Gene database.
Entrez ID 9971
Gene name Nuclear receptor subfamily 1 group H member 4
Gene symbol NR1H4
Synonyms (NCBI Gene)
BARFXRHRR-1HRR1PFIC5RIP14
Chromosome 12
Chromosome location 12q23.1
Summary This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs113090017 C>A,G,T Pathogenic Synonymous variant, non coding transcript variant, stop gained, intron variant, coding sequence variant, missense variant
rs137946171 G>A Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, synonymous variant
rs140648896 T>C Conflicting-interpretations-of-pathogenicity Synonymous variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs770757947 ->A Likely-pathogenic Downstream transcript variant, coding sequence variant, non coding transcript variant, frameshift variant, genic downstream transcript variant
rs879255644 ->AAA Pathogenic Inframe insertion, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
21
miRTarBase ID miRNA Experiments Reference
MIRT054133 hsa-miR-92a-3p Luciferase reporter assayqRT-PCRWestern blot 25095974
MIRT054133 hsa-miR-92a-3p Luciferase reporter assayqRT-PCRWestern blot 25095974
MIRT731905 hsa-miR-192-3p Luciferase reporter assay 27079614
MIRT731905 hsa-miR-192-3p Luciferase reporter assay 27079614
MIRT756465 hsa-miR-382-5p Luciferase reporter assay 34712060
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
EP300 Repression 18842595
IRF6 Unknown 12525500
IRF7 Unknown 23372731
NR0B1 Repression 21856289
STAT1 Repression 19393742
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
113
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS 21757002
GO:0000785 Component Chromatin IC 27471003
GO:0000785 Component Chromatin ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603826 7967 ENSG00000012504
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96RI1
Protein name Bile acid receptor (Farnesoid X-activated receptor) (Farnesol receptor HRR-1) (Nuclear receptor subfamily 1 group H member 4) (Retinoid X receptor-interacting protein 14) (RXR-interacting protein 14)
Protein function Ligand-activated transcription factor. Receptor for bile acids (BAs) such as chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA) and allocholic acid (ACA). Plays a essential role in BA homeostasis through the regulation of gen
PDB 1OSH , 3BEJ , 3DCT , 3DCU , 3FLI , 3FXV , 3GD2 , 3HC5 , 3HC6 , 3L1B , 3OKH , 3OKI , 3OLF , 3OMK , 3OMM , 3OOF , 3OOK , 3P88 , 3P89 , 3RUT , 3RUU , 3RVF , 4OIV , 4QE8 , 4WVD , 5IAW , 5ICK , 5Q0I , 5Q0J , 5Q0K , 5Q0L , 5Q0M , 5Q0N , 5Q0O , 5Q0P , 5Q0Q , 5Q0R , 5Q0S , 5Q0T , 5Q0U , 5Q0V , 5Q0W , 5Q0X , 5Q0Y , 5Q0Z , 5Q10 , 5Q11 , 5Q12 , 5Q13 , 5Q14 , 5Q15
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 135 204 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 289 471 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Liver and hepatocyte-related cells express mainly FXRalpha1-type isoforms with isoform 3 and isoform 4 in approximately equal proportions. In intestine and kidney mainly FXRalpha2-type isoforms are expressed with isoform 1 and isoform
Sequence
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLA
ECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEG
RDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVN
DHKFTPLLC
EIWDVQ
Sequence length 486
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Bile secretion   Recycling of bile acids and salts
Synthesis of bile acids and bile salts
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
Synthesis of bile acids and bile salts via 27-hydroxycholesterol
PPARA activates gene expression
Endogenous sterols
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
33
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cholestasis, progressive familial intrahepatic, 5 Likely pathogenic; Pathogenic rs1251445242, rs1555335782, rs879255644, rs113090017, rs2500820482, rs2500723504, rs1313639936, rs1593114820 RCV001824258
RCV002244148
RCV000239480
RCV000239570
RCV003492890
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NR1H4-related disorder Pathogenic; Likely pathogenic rs879255644, rs113090017, rs1555335782 RCV004754355
RCV004754356
RCV004754482
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Progressive familial intrahepatic cholestasis type 1 Pathogenic rs879255644, rs113090017 RCV000240839
RCV000240831
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATHEROSCLEROSIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHOLESTASIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 25470824
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 17054793
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Of Esophagus Esophageal Cancer BEFREE 19926617, 21525435, 24025864, 28293080
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 26609171
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 29730159, 30803859
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 31070281
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 29976576, 30013964, 30026549, 30996006
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 31670489 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 29976576, 30013964, 30026549, 30996006
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Atherosclerosis Atherosclerosis CTD_human_DG 30996006
★★☆☆☆
Found in Text Mining + Unknown/Other Associations