Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9966
Gene name	TNF superfamily member 15
Gene symbol	TNFSF15
Synonyms (NCBI Gene)	TL1TL1ATNLG1BVEGIVEGI192A
Chromosome	9
Chromosome location	9q32
Summary	The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducib

544

Show/Hide all (544)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029860	hsa-miR-26b-5p	Microarray	19088304
MIRT676835	hsa-miR-3929	HITS-CLIP	23824327
MIRT676834	hsa-miR-4419b	HITS-CLIP	23824327
MIRT676833	hsa-miR-4478	HITS-CLIP	23824327
MIRT676832	hsa-miR-128-3p	HITS-CLIP	23824327
MIRT676831	hsa-miR-216a-3p	HITS-CLIP	23824327
MIRT676830	hsa-miR-3681-3p	HITS-CLIP	23824327
MIRT676829	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT676828	hsa-miR-5693	HITS-CLIP	23824327
MIRT676827	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT676826	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT676825	hsa-miR-4533	HITS-CLIP	23824327
MIRT676824	hsa-miR-3202	HITS-CLIP	23824327
MIRT676823	hsa-miR-4284	HITS-CLIP	23824327
MIRT676822	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT676821	hsa-miR-7977	HITS-CLIP	23824327
MIRT676820	hsa-miR-6079	HITS-CLIP	23824327
MIRT652324	hsa-miR-1183	HITS-CLIP	23824327
MIRT652322	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT652323	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT652321	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT652320	hsa-miR-4693-5p	HITS-CLIP	23824327
MIRT652319	hsa-miR-623	HITS-CLIP	23824327
MIRT652318	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT652317	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT652316	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT639367	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT445685	hsa-miR-548ac	PAR-CLIP	22100165
MIRT445684	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT445683	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445682	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445681	hsa-miR-548z	PAR-CLIP	22100165
MIRT445680	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445679	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445678	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445677	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445676	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445675	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445674	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445673	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445672	hsa-miR-34a-3p	PAR-CLIP	22100165
MIRT445671	hsa-miR-3617-3p	PAR-CLIP	22100165
MIRT445670	hsa-miR-8063	PAR-CLIP	22100165
MIRT445669	hsa-miR-922	PAR-CLIP	22100165
MIRT445668	hsa-miR-214-3p	PAR-CLIP	22100165
MIRT445666	hsa-miR-3619-5p	PAR-CLIP	22100165
MIRT445667	hsa-miR-761	PAR-CLIP	22100165
MIRT445665	hsa-miR-545-5p	PAR-CLIP	22100165
MIRT445664	hsa-miR-610	PAR-CLIP	22100165
MIRT445663	hsa-miR-4291	PAR-CLIP	22100165
MIRT676835	hsa-miR-3929	PAR-CLIP	27292025
MIRT676834	hsa-miR-4419b	PAR-CLIP	27292025
MIRT676833	hsa-miR-4478	PAR-CLIP	27292025
MIRT676827	hsa-miR-4649-3p	PAR-CLIP	27292025
MIRT676826	hsa-miR-7160-5p	PAR-CLIP	27292025
MIRT676835	hsa-miR-3929	HITS-CLIP	23824327
MIRT676834	hsa-miR-4419b	HITS-CLIP	23824327
MIRT676833	hsa-miR-4478	HITS-CLIP	23824327
MIRT676832	hsa-miR-128-3p	HITS-CLIP	23824327
MIRT676831	hsa-miR-216a-3p	HITS-CLIP	23824327
MIRT676830	hsa-miR-3681-3p	HITS-CLIP	23824327
MIRT676829	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT676828	hsa-miR-5693	HITS-CLIP	23824327
MIRT676827	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT676826	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT676825	hsa-miR-4533	HITS-CLIP	23824327
MIRT676824	hsa-miR-3202	HITS-CLIP	23824327
MIRT676823	hsa-miR-4284	HITS-CLIP	23824327
MIRT676822	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT676821	hsa-miR-7977	HITS-CLIP	23824327
MIRT676820	hsa-miR-6079	HITS-CLIP	23824327
MIRT652324	hsa-miR-1183	HITS-CLIP	23824327
MIRT652322	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT652323	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT652321	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT652320	hsa-miR-4693-5p	HITS-CLIP	23824327
MIRT652319	hsa-miR-623	HITS-CLIP	23824327
MIRT652318	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT652317	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT652316	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT639367	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT615552	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT615551	hsa-miR-1470	HITS-CLIP	23824327
MIRT615550	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT615549	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT615548	hsa-miR-4469	HITS-CLIP	23824327
MIRT615547	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT615546	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT615545	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615544	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615543	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615542	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT445685	hsa-miR-548ac	PAR-CLIP	22100165
MIRT445684	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT445683	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445682	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445681	hsa-miR-548z	PAR-CLIP	22100165
MIRT445680	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445679	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445678	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445677	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445676	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445675	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445674	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445673	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445672	hsa-miR-34a-3p	PAR-CLIP	22100165
MIRT445671	hsa-miR-3617-3p	PAR-CLIP	22100165
MIRT445670	hsa-miR-8063	PAR-CLIP	22100165
MIRT445669	hsa-miR-922	PAR-CLIP	22100165
MIRT445668	hsa-miR-214-3p	PAR-CLIP	22100165
MIRT445666	hsa-miR-3619-5p	PAR-CLIP	22100165
MIRT445667	hsa-miR-761	PAR-CLIP	22100165
MIRT445665	hsa-miR-545-5p	PAR-CLIP	22100165
MIRT445664	hsa-miR-610	PAR-CLIP	22100165
MIRT445663	hsa-miR-4291	PAR-CLIP	22100165
MIRT1443402	hsa-miR-1	CLIP-seq
MIRT1443403	hsa-miR-103b	CLIP-seq
MIRT1443404	hsa-miR-1200	CLIP-seq
MIRT1443405	hsa-miR-1225-3p	CLIP-seq
MIRT1443406	hsa-miR-1233	CLIP-seq
MIRT1443407	hsa-miR-1234	CLIP-seq
MIRT1443408	hsa-miR-1262	CLIP-seq
MIRT1443409	hsa-miR-1273f	CLIP-seq
MIRT1443410	hsa-miR-128	CLIP-seq
MIRT1443411	hsa-miR-1283	CLIP-seq
MIRT1443412	hsa-miR-129-3p	CLIP-seq
MIRT1443413	hsa-miR-1537	CLIP-seq
MIRT1443414	hsa-miR-2052	CLIP-seq
MIRT1443415	hsa-miR-206	CLIP-seq
MIRT1443416	hsa-miR-2114	CLIP-seq
MIRT1443417	hsa-miR-24	CLIP-seq
MIRT1443418	hsa-miR-31	CLIP-seq
MIRT1443419	hsa-miR-3149	CLIP-seq
MIRT1443420	hsa-miR-3157-5p	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT1443422	hsa-miR-3182	CLIP-seq
MIRT1443423	hsa-miR-3190	CLIP-seq
MIRT1443424	hsa-miR-3689d	CLIP-seq
MIRT1443425	hsa-miR-376a	CLIP-seq
MIRT1443426	hsa-miR-376b	CLIP-seq
MIRT1443427	hsa-miR-3923	CLIP-seq
MIRT1443428	hsa-miR-411	CLIP-seq
MIRT1443429	hsa-miR-4252	CLIP-seq
MIRT1443430	hsa-miR-4324	CLIP-seq
MIRT1443431	hsa-miR-4325	CLIP-seq
MIRT1443432	hsa-miR-4475	CLIP-seq
MIRT1443433	hsa-miR-4477b	CLIP-seq
MIRT1443434	hsa-miR-4504	CLIP-seq
MIRT1443435	hsa-miR-451	CLIP-seq
MIRT1443436	hsa-miR-4659a-3p	CLIP-seq
MIRT1443437	hsa-miR-4659b-3p	CLIP-seq
MIRT1443438	hsa-miR-4668-5p	CLIP-seq
MIRT1443439	hsa-miR-4676-5p	CLIP-seq
MIRT1443440	hsa-miR-4701-3p	CLIP-seq
MIRT1443441	hsa-miR-4704-5p	CLIP-seq
MIRT1443442	hsa-miR-4722-3p	CLIP-seq
MIRT1443443	hsa-miR-4722-5p	CLIP-seq
MIRT1443444	hsa-miR-4727-5p	CLIP-seq
MIRT1443445	hsa-miR-4735-5p	CLIP-seq
MIRT1443446	hsa-miR-4747-5p	CLIP-seq
MIRT1443447	hsa-miR-4752	CLIP-seq
MIRT1443448	hsa-miR-4756-3p	CLIP-seq
MIRT1443449	hsa-miR-4760-3p	CLIP-seq
MIRT1443450	hsa-miR-4775	CLIP-seq
MIRT1443451	hsa-miR-4793-3p	CLIP-seq
MIRT1443452	hsa-miR-4797-3p	CLIP-seq
MIRT1443453	hsa-miR-483-3p	CLIP-seq
MIRT1443454	hsa-miR-485-3p	CLIP-seq
MIRT1443455	hsa-miR-485-5p	CLIP-seq
MIRT1443456	hsa-miR-510	CLIP-seq
MIRT1443457	hsa-miR-512-5p	CLIP-seq
MIRT1443458	hsa-miR-513a-3p	CLIP-seq
MIRT1443459	hsa-miR-539	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT1443461	hsa-miR-544b	CLIP-seq
MIRT1443462	hsa-miR-575	CLIP-seq
MIRT1443463	hsa-miR-580	CLIP-seq
MIRT1443464	hsa-miR-590-3p	CLIP-seq
MIRT1443465	hsa-miR-613	CLIP-seq
MIRT1443466	hsa-miR-654-3p	CLIP-seq
MIRT1443467	hsa-miR-661	CLIP-seq
MIRT1443468	hsa-miR-758	CLIP-seq
MIRT1443402	hsa-miR-1	CLIP-seq
MIRT1443469	hsa-miR-122	CLIP-seq
MIRT1443405	hsa-miR-1225-3p	CLIP-seq
MIRT1443406	hsa-miR-1233	CLIP-seq
MIRT1443408	hsa-miR-1262	CLIP-seq
MIRT1443410	hsa-miR-128	CLIP-seq
MIRT1443411	hsa-miR-1283	CLIP-seq
MIRT1443470	hsa-miR-1285	CLIP-seq
MIRT1443412	hsa-miR-129-3p	CLIP-seq
MIRT1443471	hsa-miR-1303	CLIP-seq
MIRT1443472	hsa-miR-130a	CLIP-seq
MIRT1443473	hsa-miR-130b	CLIP-seq
MIRT1443474	hsa-miR-151-3p	CLIP-seq
MIRT1443475	hsa-miR-1912	CLIP-seq
MIRT1443415	hsa-miR-206	CLIP-seq
MIRT1443417	hsa-miR-24	CLIP-seq
MIRT1443476	hsa-miR-2681	CLIP-seq
MIRT1443477	hsa-miR-301a	CLIP-seq
MIRT1443478	hsa-miR-301b	CLIP-seq
MIRT1443479	hsa-miR-3065-5p	CLIP-seq
MIRT1443480	hsa-miR-3121-3p	CLIP-seq
MIRT1443481	hsa-miR-3130-5p	CLIP-seq
MIRT1443482	hsa-miR-3135b	CLIP-seq
MIRT1443483	hsa-miR-3150a-5p	CLIP-seq
MIRT1443484	hsa-miR-3150b-5p	CLIP-seq
MIRT1443485	hsa-miR-3156-5p	CLIP-seq
MIRT1443420	hsa-miR-3157-5p	CLIP-seq
MIRT1443486	hsa-miR-3166	CLIP-seq
MIRT1443487	hsa-miR-3187-5p	CLIP-seq
MIRT1443488	hsa-miR-3652	CLIP-seq
MIRT1443489	hsa-miR-3666	CLIP-seq
MIRT1443490	hsa-miR-3678-3p	CLIP-seq
MIRT1443491	hsa-miR-3688-3p	CLIP-seq
MIRT1443492	hsa-miR-370	CLIP-seq
MIRT1443493	hsa-miR-378g	CLIP-seq
MIRT1443429	hsa-miR-4252	CLIP-seq
MIRT1443494	hsa-miR-4261	CLIP-seq
MIRT1443495	hsa-miR-4295	CLIP-seq
MIRT1443431	hsa-miR-4325	CLIP-seq
MIRT1443496	hsa-miR-4430	CLIP-seq
MIRT1443497	hsa-miR-4433	CLIP-seq
MIRT1443498	hsa-miR-4463	CLIP-seq
MIRT1443499	hsa-miR-4482	CLIP-seq
MIRT1443500	hsa-miR-4486	CLIP-seq
MIRT1443501	hsa-miR-4499	CLIP-seq
MIRT1443434	hsa-miR-4504	CLIP-seq
MIRT1443502	hsa-miR-454	CLIP-seq
MIRT1443503	hsa-miR-4634	CLIP-seq
MIRT1443504	hsa-miR-4643	CLIP-seq
MIRT1443505	hsa-miR-4684-3p	CLIP-seq
MIRT1443440	hsa-miR-4701-3p	CLIP-seq
MIRT1443506	hsa-miR-4717-3p	CLIP-seq
MIRT1443442	hsa-miR-4722-3p	CLIP-seq
MIRT1443443	hsa-miR-4722-5p	CLIP-seq
MIRT1443444	hsa-miR-4727-5p	CLIP-seq
MIRT1443507	hsa-miR-4769-3p	CLIP-seq
MIRT1443508	hsa-miR-4771	CLIP-seq
MIRT1443509	hsa-miR-4786-5p	CLIP-seq
MIRT1443451	hsa-miR-4793-3p	CLIP-seq
MIRT1443510	hsa-miR-4793-5p	CLIP-seq
MIRT1443511	hsa-miR-4794	CLIP-seq
MIRT1443512	hsa-miR-4802-3p	CLIP-seq
MIRT1443455	hsa-miR-485-5p	CLIP-seq
MIRT1443513	hsa-miR-490-5p	CLIP-seq
MIRT1443514	hsa-miR-505	CLIP-seq
MIRT1443515	hsa-miR-518a-5p	CLIP-seq
MIRT1443516	hsa-miR-527	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT1443517	hsa-miR-612	CLIP-seq
MIRT1443465	hsa-miR-613	CLIP-seq
MIRT1443518	hsa-miR-652	CLIP-seq
MIRT1443466	hsa-miR-654-3p	CLIP-seq
MIRT1443467	hsa-miR-661	CLIP-seq
MIRT1443468	hsa-miR-758	CLIP-seq
MIRT2132711	hsa-miR-1224-3p	CLIP-seq
MIRT2132712	hsa-miR-1252	CLIP-seq
MIRT2132713	hsa-miR-1290	CLIP-seq
MIRT2132714	hsa-miR-2110	CLIP-seq
MIRT2132715	hsa-miR-3152-5p	CLIP-seq
MIRT2132716	hsa-miR-382	CLIP-seq
MIRT2132717	hsa-miR-4271	CLIP-seq
MIRT2132718	hsa-miR-4330	CLIP-seq
MIRT2132719	hsa-miR-4432	CLIP-seq
MIRT1443497	hsa-miR-4433	CLIP-seq
MIRT2132720	hsa-miR-4477a	CLIP-seq
MIRT2132721	hsa-miR-4487	CLIP-seq
MIRT2132722	hsa-miR-4522	CLIP-seq
MIRT2132723	hsa-miR-4667-5p	CLIP-seq
MIRT2132724	hsa-miR-4700-5p	CLIP-seq
MIRT2132725	hsa-miR-4711-3p	CLIP-seq
MIRT2132726	hsa-miR-4725-3p	CLIP-seq
MIRT2132727	hsa-miR-4731-5p	CLIP-seq
MIRT2132728	hsa-miR-4774-3p	CLIP-seq
MIRT1443509	hsa-miR-4786-5p	CLIP-seq
MIRT1443510	hsa-miR-4793-5p	CLIP-seq
MIRT1443511	hsa-miR-4794	CLIP-seq
MIRT2132729	hsa-miR-640	CLIP-seq
MIRT2353765	hsa-miR-4251	CLIP-seq
MIRT1443458	hsa-miR-513a-3p	CLIP-seq
MIRT2353766	hsa-miR-584	CLIP-seq
MIRT2353767	hsa-miR-1178	CLIP-seq
MIRT2132711	hsa-miR-1224-3p	CLIP-seq
MIRT2132712	hsa-miR-1252	CLIP-seq
MIRT1443470	hsa-miR-1285	CLIP-seq
MIRT2132713	hsa-miR-1290	CLIP-seq
MIRT2353768	hsa-miR-1323	CLIP-seq
MIRT2353769	hsa-miR-138	CLIP-seq
MIRT2353770	hsa-miR-150	CLIP-seq
MIRT2353771	hsa-miR-1827	CLIP-seq
MIRT2353772	hsa-miR-193a-3p	CLIP-seq
MIRT2353773	hsa-miR-193b	CLIP-seq
MIRT2353774	hsa-miR-199a-3p	CLIP-seq
MIRT2353775	hsa-miR-199b-3p	CLIP-seq
MIRT1443416	hsa-miR-2114	CLIP-seq
MIRT2353776	hsa-miR-2467-3p	CLIP-seq
MIRT2353777	hsa-miR-3117-3p	CLIP-seq
MIRT2353778	hsa-miR-3120-5p	CLIP-seq
MIRT2353779	hsa-miR-3129-5p	CLIP-seq
MIRT2353780	hsa-miR-3147	CLIP-seq
MIRT2132715	hsa-miR-3152-5p	CLIP-seq
MIRT2353781	hsa-miR-3169	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT1443487	hsa-miR-3187-5p	CLIP-seq
MIRT2353782	hsa-miR-3192	CLIP-seq
MIRT2353783	hsa-miR-3612	CLIP-seq
MIRT2353784	hsa-miR-3650	CLIP-seq
MIRT2353785	hsa-miR-3664-3p	CLIP-seq
MIRT2353786	hsa-miR-3667-3p	CLIP-seq
MIRT2353787	hsa-miR-3689a-3p	CLIP-seq
MIRT2353788	hsa-miR-3689c	CLIP-seq
MIRT2353789	hsa-miR-3692	CLIP-seq
MIRT1443493	hsa-miR-378g	CLIP-seq
MIRT1443429	hsa-miR-4252	CLIP-seq
MIRT2353790	hsa-miR-4257	CLIP-seq
MIRT2353791	hsa-miR-4300	CLIP-seq
MIRT2353792	hsa-miR-4425	CLIP-seq
MIRT1443497	hsa-miR-4433	CLIP-seq
MIRT1443500	hsa-miR-4486	CLIP-seq
MIRT2353793	hsa-miR-450b-3p	CLIP-seq
MIRT2353794	hsa-miR-4536	CLIP-seq
MIRT2353795	hsa-miR-4645-5p	CLIP-seq
MIRT2353796	hsa-miR-4673	CLIP-seq
MIRT2353797	hsa-miR-4688	CLIP-seq
MIRT2353798	hsa-miR-4701-5p	CLIP-seq
MIRT1443506	hsa-miR-4717-3p	CLIP-seq
MIRT1443443	hsa-miR-4722-5p	CLIP-seq
MIRT2353799	hsa-miR-4728-5p	CLIP-seq
MIRT2353800	hsa-miR-4729	CLIP-seq
MIRT2353801	hsa-miR-4759	CLIP-seq
MIRT2132728	hsa-miR-4774-3p	CLIP-seq
MIRT1443452	hsa-miR-4797-3p	CLIP-seq
MIRT1443455	hsa-miR-485-5p	CLIP-seq
MIRT2353802	hsa-miR-486-3p	CLIP-seq
MIRT2353803	hsa-miR-490-3p	CLIP-seq
MIRT2353804	hsa-miR-5095	CLIP-seq
MIRT1443456	hsa-miR-510	CLIP-seq
MIRT1443457	hsa-miR-512-5p	CLIP-seq
MIRT2353805	hsa-miR-520g	CLIP-seq
MIRT2353806	hsa-miR-520h	CLIP-seq
MIRT2353807	hsa-miR-541	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT2353808	hsa-miR-548o	CLIP-seq
MIRT2353809	hsa-miR-552	CLIP-seq
MIRT2353810	hsa-miR-588	CLIP-seq
MIRT1443517	hsa-miR-612	CLIP-seq
MIRT2132729	hsa-miR-640	CLIP-seq
MIRT2353811	hsa-miR-650	CLIP-seq
MIRT2353812	hsa-miR-654-5p	CLIP-seq
MIRT1443467	hsa-miR-661	CLIP-seq
MIRT2353813	hsa-miR-668	CLIP-seq
MIRT2353814	hsa-miR-769-3p	CLIP-seq
MIRT2353815	hsa-miR-889	CLIP-seq
MIRT2353816	hsa-miR-920	CLIP-seq
MIRT2353817	hsa-miR-936	CLIP-seq
MIRT1443411	hsa-miR-1283	CLIP-seq
MIRT2353777	hsa-miR-3117-3p	CLIP-seq
MIRT2353781	hsa-miR-3169	CLIP-seq
MIRT2396133	hsa-miR-4464	CLIP-seq
MIRT1443436	hsa-miR-4659a-3p	CLIP-seq
MIRT1443437	hsa-miR-4659b-3p	CLIP-seq
MIRT2396134	hsa-miR-4677-3p	CLIP-seq
MIRT2396135	hsa-miR-4693-3p	CLIP-seq
MIRT2396136	hsa-miR-4748	CLIP-seq
MIRT2353801	hsa-miR-4759	CLIP-seq
MIRT2396137	hsa-miR-4789-5p	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT1443467	hsa-miR-661	CLIP-seq
MIRT1443409	hsa-miR-1273f	CLIP-seq
MIRT1443419	hsa-miR-3149	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT2462095	hsa-miR-3613-3p	CLIP-seq
MIRT2462096	hsa-miR-3622b-5p	CLIP-seq
MIRT2462097	hsa-miR-3691-5p	CLIP-seq
MIRT2462098	hsa-miR-3911	CLIP-seq
MIRT1443428	hsa-miR-411	CLIP-seq
MIRT2462099	hsa-miR-4253	CLIP-seq
MIRT2462100	hsa-miR-4455	CLIP-seq
MIRT2462101	hsa-miR-4684-5p	CLIP-seq
MIRT1443445	hsa-miR-4735-5p	CLIP-seq
MIRT1443447	hsa-miR-4752	CLIP-seq
MIRT2462102	hsa-miR-4764-5p	CLIP-seq
MIRT1443450	hsa-miR-4775	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT2462103	hsa-miR-548c-3p	CLIP-seq
MIRT1443464	hsa-miR-590-3p	CLIP-seq
MIRT1443409	hsa-miR-1273f	CLIP-seq
MIRT1443419	hsa-miR-3149	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT2462095	hsa-miR-3613-3p	CLIP-seq
MIRT2462096	hsa-miR-3622b-5p	CLIP-seq
MIRT1443428	hsa-miR-411	CLIP-seq
MIRT2462099	hsa-miR-4253	CLIP-seq
MIRT2462101	hsa-miR-4684-5p	CLIP-seq
MIRT1443445	hsa-miR-4735-5p	CLIP-seq
MIRT1443450	hsa-miR-4775	CLIP-seq
MIRT2462103	hsa-miR-548c-3p	CLIP-seq
MIRT1443464	hsa-miR-590-3p	CLIP-seq
MIRT1443409	hsa-miR-1273f	CLIP-seq
MIRT2353772	hsa-miR-193a-3p	CLIP-seq
MIRT2353773	hsa-miR-193b	CLIP-seq
MIRT2647884	hsa-miR-2355-5p	CLIP-seq
MIRT1443419	hsa-miR-3149	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT2462095	hsa-miR-3613-3p	CLIP-seq
MIRT2462096	hsa-miR-3622b-5p	CLIP-seq
MIRT2462097	hsa-miR-3691-5p	CLIP-seq
MIRT2647885	hsa-miR-371-5p	CLIP-seq
MIRT2647886	hsa-miR-371b-5p	CLIP-seq
MIRT2647887	hsa-miR-384	CLIP-seq
MIRT2462098	hsa-miR-3911	CLIP-seq
MIRT1443428	hsa-miR-411	CLIP-seq
MIRT2462099	hsa-miR-4253	CLIP-seq
MIRT2462100	hsa-miR-4455	CLIP-seq
MIRT2462101	hsa-miR-4684-5p	CLIP-seq
MIRT2353798	hsa-miR-4701-5p	CLIP-seq
MIRT1443445	hsa-miR-4735-5p	CLIP-seq
MIRT1443447	hsa-miR-4752	CLIP-seq
MIRT2462102	hsa-miR-4764-5p	CLIP-seq
MIRT1443450	hsa-miR-4775	CLIP-seq
MIRT2647888	hsa-miR-498	CLIP-seq
MIRT2647889	hsa-miR-515-5p	CLIP-seq
MIRT2647890	hsa-miR-516a-3p	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT2462103	hsa-miR-548c-3p	CLIP-seq
MIRT2353766	hsa-miR-584	CLIP-seq
MIRT2353810	hsa-miR-588	CLIP-seq
MIRT1443464	hsa-miR-590-3p	CLIP-seq
MIRT2647891	hsa-miR-7	CLIP-seq
MIRT2647892	hsa-miR-873	CLIP-seq
MIRT1443408	hsa-miR-1262	CLIP-seq
MIRT1443409	hsa-miR-1273f	CLIP-seq
MIRT2353772	hsa-miR-193a-3p	CLIP-seq
MIRT2353773	hsa-miR-193b	CLIP-seq
MIRT1443416	hsa-miR-2114	CLIP-seq
MIRT2647884	hsa-miR-2355-5p	CLIP-seq
MIRT1443419	hsa-miR-3149	CLIP-seq
MIRT1443420	hsa-miR-3157-5p	CLIP-seq
MIRT1443421	hsa-miR-3170	CLIP-seq
MIRT1443422	hsa-miR-3182	CLIP-seq
MIRT2693741	hsa-miR-3189-3p	CLIP-seq
MIRT2693742	hsa-miR-323-5p	CLIP-seq
MIRT2462095	hsa-miR-3613-3p	CLIP-seq
MIRT2462096	hsa-miR-3622b-5p	CLIP-seq
MIRT2462097	hsa-miR-3691-5p	CLIP-seq
MIRT2462098	hsa-miR-3911	CLIP-seq
MIRT2693743	hsa-miR-3921	CLIP-seq
MIRT2693744	hsa-miR-3978	CLIP-seq
MIRT1443428	hsa-miR-411	CLIP-seq
MIRT1443429	hsa-miR-4252	CLIP-seq
MIRT2462099	hsa-miR-4253	CLIP-seq
MIRT1443494	hsa-miR-4261	CLIP-seq
MIRT2693745	hsa-miR-4268	CLIP-seq
MIRT2353791	hsa-miR-4300	CLIP-seq
MIRT2693746	hsa-miR-4303	CLIP-seq
MIRT1443431	hsa-miR-4325	CLIP-seq
MIRT1443497	hsa-miR-4433	CLIP-seq
MIRT2693747	hsa-miR-4448	CLIP-seq
MIRT2462100	hsa-miR-4455	CLIP-seq
MIRT1443434	hsa-miR-4504	CLIP-seq
MIRT2693748	hsa-miR-4653-5p	CLIP-seq
MIRT1443436	hsa-miR-4659a-3p	CLIP-seq
MIRT1443437	hsa-miR-4659b-3p	CLIP-seq
MIRT2462101	hsa-miR-4684-5p	CLIP-seq
MIRT1443440	hsa-miR-4701-3p	CLIP-seq
MIRT2353798	hsa-miR-4701-5p	CLIP-seq
MIRT1443443	hsa-miR-4722-5p	CLIP-seq
MIRT1443445	hsa-miR-4735-5p	CLIP-seq
MIRT1443447	hsa-miR-4752	CLIP-seq
MIRT2462102	hsa-miR-4764-5p	CLIP-seq
MIRT1443450	hsa-miR-4775	CLIP-seq
MIRT1443451	hsa-miR-4793-3p	CLIP-seq
MIRT1443455	hsa-miR-485-5p	CLIP-seq
MIRT2647888	hsa-miR-498	CLIP-seq
MIRT2647889	hsa-miR-515-5p	CLIP-seq
MIRT2353807	hsa-miR-541	CLIP-seq
MIRT1443460	hsa-miR-542-3p	CLIP-seq
MIRT2462103	hsa-miR-548c-3p	CLIP-seq
MIRT2353810	hsa-miR-588	CLIP-seq
MIRT1443464	hsa-miR-590-3p	CLIP-seq
MIRT2693749	hsa-miR-629	CLIP-seq
MIRT2693750	hsa-miR-642a	CLIP-seq
MIRT2353812	hsa-miR-654-5p	CLIP-seq
MIRT1443467	hsa-miR-661	CLIP-seq
MIRT2693751	hsa-miR-876-3p	CLIP-seq
MIRT2353816	hsa-miR-920	CLIP-seq
MIRT2353791	hsa-miR-4300	CLIP-seq
MIRT2353816	hsa-miR-920	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9434163
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	21300286, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	11911831
GO:0005886	Component	Plasma membrane	TAS	9872942
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	NAS	9872942
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	IDA	11911831
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9872942
GO:0023052	Process	Signaling	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA

MIM	HGNC	e!Ensembl
604052	11931	ENSG00000181634

O95150

Protein name

Tumor necrosis factor ligand superfamily member 15 (TNF ligand-related molecule 1) (Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily memb

Protein function

Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. {ECO:0000269|PubMed:10597252, ECO:0000269|PubMed:11911831, EC

PDB

2O0O , 2QE3 , 2RE9 , 2RJK , 2RJL , 3K51 , 3MI8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	117 → 251	TNF(Tumour Necrosis Factor) family	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. {ECO:0000269|PubMed:11911831, ECO:0000269|PubMed:11923219, ECO:0

Sequence

MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL

Sequence length

251

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFs bind their physiological receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy, susceptibility to, 1	confers sensitivity; Uncertain risk allele	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (175)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Sickle Cell	Sickle cell anemia	Pubtator	19251437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31255916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24453414, 26200500, 26823868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	30213220, 31646918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18757243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18824582, 19786547, 29803925, 30488533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25148371, 26956410, 31953914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	24269700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	29436901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	34022066	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15760679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30213220, 31646918		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22017439, 24140642, 24453414, 25200589, 26200500, 28000874, 28278297, 28942944, 29748156, 31081141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23565196, 25148371, 28278297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	23000144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24824261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40666524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30736740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37903974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30736740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35063404, 36429070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22210436, 24141405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chilblains	Chilblain lesions	BEFREE	29803925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	29254800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27733581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	27861181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26393680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27233964, 29254800, 29436901, 29988118, 30552020, 30972074, 31176785, 31358760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17663424, 20848476, 21818367, 25501099, 26072972, 37156999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19262684, 20176734, 24382939	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30788683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21730793, 21818367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20349123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29796912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30788683, 34814366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	21636646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23545578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29638194, 30213220, 31646918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	14568967, 15207783, 16221758, 17030188, 17663424, 18338776, 18422820, 19124533, 19174806, 19262684, 19592695, 20176734, 20367632, 21228792, 21636646 View all (28 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	14568967, 18422820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	16221758, 18587394, 21102463, 23266558		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	17663424, 19262684, 19637197, 20117335, 20176734, 21548950, 21636646, 21730793, 21752155, 21818367, 21930071, 24945726, 25501099, 27507062, 27733581 View all (6 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	18587394, 21102463, 26192919, 26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	26072972	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	CTD_human_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28456797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21672030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36768135	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25200589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatographic urticaria	Dermatographic urticaria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24269700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28000874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28427244	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32732304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20176734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27120595, 28000874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	24814505, 28624054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25200589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	CTD_human_DG	20980995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	25182731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30906791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25251497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26297987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28219835, 29751114, 31379829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	27861181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	14568967, 18422820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	31242765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	31242765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	22684480, 23594334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	29988118, 30295722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30972074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	14568967, 15207783, 16221758, 17663424, 18422820, 19174806, 19262684, 20980995, 23250276, 24453414, 25197060, 25501099, 26072972, 27001939, 27233964 View all (18 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	14568967, 16221758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17663424, 19262684, 19839006, 23250276, 24382939, 25148371, 25197060, 25501099, 26072972, 27001939, 27861181, 28400196, 30199539, 31758576, 32651235, 34427649 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19637197, 19839006	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	26192919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30199539	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	21672030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19262684, 21636646, 21752155, 22403795, 22684480, 23594334, 24453414, 25824902, 29988118, 31615448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21636646, 21752155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24763552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	GWASCAT_DG	20018961, 25642632		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	GWASDB_DG	20018961, 22019778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	25197060, 27507062	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	BEFREE	27507062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	26393680	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38022627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21500188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37321146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23000144, 25690649, 27507062, 29773854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30736740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31081141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31081141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29803925, 31081141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31081141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29890027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24824261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30736740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22210436, 24141405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21217782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31571922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19918267, 29497138, 30788683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30788683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31953914	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	31445379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36226563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31445379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31445379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11923219, 19918267, 21217782, 22210436, 23545578, 24141405, 25182731, 26297987, 29796912, 29890027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	32554042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	32554042	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32732304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36799242	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28062298, 31299941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22210436, 24141405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16036106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	35887121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27120595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cholangitis	Biliary Cholangitis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23000144, 24453414, 25899471, 26084578, 27507062, 28062665, 29773854, 30906791		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	ORPHANET_DG	23000144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	23000144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	23000144, 28062665, 30643196		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27120595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21217782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21217782	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33197890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21672030, 24269700, 25200589, 28973304		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25200589, 30341229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23545578		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 9	Retinitis Pigmentosa	BEFREE	17349692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17513783, 18757243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18824582, 19786547, 24140642, 24453414, 24832108, 25200589, 25647275, 28696795, 29748156, 30488533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	18824582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	21672030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30736740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30736740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	19543369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	19543369, 26823868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31571922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25251497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28397078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15207783, 17663424, 19262684, 19592695, 20176734, 20367632, 20675196, 20848476, 21228792, 21818367, 23942620, 24382939, 24783249, 24814505, 25028192 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	17663424		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20228799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	21297633, 26192919, 26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	21297633		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TNFSF15 (TNF superfamily member 15)