FGF19 (fibroblast growth factor 19)

Gene

• Entrez ID: 9965
• Gene name: Fibroblast growth factor 19
• Gene symbol: FGF19
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT995620	hsa-miR-1207-3p	CLIP-seq
MIRT995621	hsa-miR-1285	CLIP-seq
MIRT995622	hsa-miR-136	CLIP-seq
MIRT995623	hsa-miR-148a	CLIP-seq
MIRT995624	hsa-miR-148b	CLIP-seq
MIRT995625	hsa-miR-152	CLIP-seq
MIRT995626	hsa-miR-2355-5p	CLIP-seq
MIRT995627	hsa-miR-3174	CLIP-seq
MIRT995628	hsa-miR-3187-5p	CLIP-seq
MIRT995629	hsa-miR-3681	CLIP-seq
MIRT995630	hsa-miR-370	CLIP-seq
MIRT995631	hsa-miR-4272	CLIP-seq
MIRT995632	hsa-miR-4329	CLIP-seq
MIRT995633	hsa-miR-4514	CLIP-seq
MIRT995634	hsa-miR-4645-5p	CLIP-seq
MIRT995635	hsa-miR-4673	CLIP-seq
MIRT995636	hsa-miR-4692	CLIP-seq
MIRT995637	hsa-miR-4797-5p	CLIP-seq
MIRT995638	hsa-miR-495	CLIP-seq
MIRT995639	hsa-miR-498	CLIP-seq
MIRT995640	hsa-miR-612	CLIP-seq
MIRT995641	hsa-miR-646	CLIP-seq
MIRT995642	hsa-miR-759	CLIP-seq
MIRT995643	hsa-miR-889	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	23205607
FOXC1	Activation	17000708
NR1I2	Activation	17696253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	17627937
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	10525310, 17627937
GO:0005515	Function	Protein binding	IPI	18829467
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007399	Process	Nervous system development	TAS	9931477
GO:0007507	Process	Heart development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10525310
GO:0009617	Process	Response to bacterium	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	19085950
GO:0022008	Process	Neurogenesis	IBA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045471	Process	Response to ethanol	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IDA	17623664
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12815072
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17623664, 19085950
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IDA	12815072
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IEA

Other IDs

• MIM: 603891
• HGNC: 3675
• e!Ensembl: ENSG00000162344

Protein

• UniProt ID: O95750
• Protein name: Fibroblast growth factor 19 (FGF-19)
• Protein function: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and
• PDB: 1PWA, 2P23, 6KTR, 6NFJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	43 → 157	Fibroblast growth factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO:0000269|PubMed:10525310}.
• Sequence:

  MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
  RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
  AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
  GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

• Sequence length: 216

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	30517925		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30517925		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28972963		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31409633		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39929297	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21109934		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39217396	Inhibit	★☆☆☆☆ Found in Text Mining only
Apert syndrome	Apert Syndrome	BEFREE	27339175		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30679232		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30679232		★☆☆☆☆ Found in Text Mining only
Bile Acid Malabsorption Primary	Bile acid malabsorption	Pubtator	26856750	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	31976601	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	36692476	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	38484669	Associate	★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	27384874	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12429977, 30074276		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24811890, 27192118, 39261800	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	31967847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22761904, 28906590	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	32487254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24248542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22309595, 23285165, 26498355, 27384874, 28069043, 30373752, 31063779, 31575541, 32219747, 33754043, 33794926, 35659630, 35874743, 36179047, 38048735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27447573	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26943773, 28906590	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26323668		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29765501		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31409633		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26498355		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26498355	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	31254596		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	31254596		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	26293907, 28570655, 28965883, 30063921, 30504803, 30893110, 31196636		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	28570655	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	28570655	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	24366234, 30697260		★☆☆☆☆ Found in Text Mining only
Cholestasis, progressive familial intrahepatic 1	Intrahepatic cholestasis	BEFREE	28965883		★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	30122083		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31614355		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24798001		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	22074045	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	39566744	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28982144	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17599042, 18593907, 30517925		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17599042		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17599042		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26498355		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23285165, 26498355, 36923538	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31637718		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24565842		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	16930954		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30354221		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30354221		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30354221		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23189156, 28982144, 39261800	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34491321	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30279125, 30653340		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21177529, 22442730, 25664662, 28189755, 30862680		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24260557, 29734515	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34982020	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21177529, 22442730, 25664662, 28189755, 29174027, 30862680		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23801799, 25664662	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28202005, 32344198	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23801799, 25664662	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28202005	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25664662, 27188262, 27412358, 28202005, 28413172, 28729691, 29987678, 31181641, 31273649, 31572498		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	29778534, 30243718		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21734802, 22761904, 29866946, 31851786, 33725708, 34962019	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	27447573	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28119353, 29284239, 31181641		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	23840612	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28746779, 30529590, 30893110		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31206730		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30634399		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	29654817	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	26856750	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30976983		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	30976983	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23670968, 24260557	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28972963		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	28570655		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24366234	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28691284, 30740753		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	38064228	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26125711, 33284559	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26125711		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	23187887		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12057932, 17599042, 20018895, 21397858, 22309595, 23285165, 24379610, 24728076, 24798001, 25346390, 26498355, 27384874, 27837028, 28069043, 28178326, 28189755, 28249259, 28508871, 28951455, 28983785, 29247039, 29468415, 29973237, 30223181, 30403487, 30464200, 30698907, 30784284, 31146605, 31167419, 31409633, 31529503, 31575540, 31575541, 31718608		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	25822088		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24798001, 28954507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26293907, 28570655	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	28954507		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26293907, 30122083	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	31976601	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26293907, 31976601	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12057932, 20018895		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27447573	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22689099	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24248542, 27053348	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12429977, 30074276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21397858, 31409633		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26323668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23440425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29438906		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17599042, 20595807, 22988100, 23002168, 24728076, 27837028, 28972963, 29247039, 29557750, 30074276, 30124818, 30325210, 30517925, 30518874, 31146605, 31718608		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17599042, 18593907, 30517925		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30074276		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36739402, 36881068	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	22988100, 28189755, 29883971, 30135133		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28178326, 29765501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neck Neoplasms	Neck Neoplasms	BEFREE	15942670		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12057932, 17599042, 18593907, 19008009, 21109934, 22309595, 23440425, 24728076, 26498355, 27837028, 28906590, 30517925, 30944079, 31350344, 31575540, 31575541		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	33491544	Stimulate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21616061, 28315901, 28746779, 28774887, 29866129, 30297626, 30682184, 31181641, 31442319, 31655133		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29519502, 30529590, 30679232, 30805949		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18469300, 23670968	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22442730, 22988100, 27125742, 27188262, 27412358, 28569359, 28650457, 29174027, 29883971, 30124818		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32344198	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis with pseudoglioma	Osteoporosis-Pseudoglioma Syndrome	BEFREE	10525310		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26323668		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36751636	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29438906		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24260557		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24260557	Inhibit	★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26866350		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	26293907, 27696157, 28570655, 29968724, 30900136		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26866350, 27696157, 30414864		★☆☆☆☆ Found in Text Mining only
Progressive intrahepatic cholestasis (disorder)	Intrahepatic Cholestasis	BEFREE	28965883		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23440425		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31074061		★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	BEFREE	30976983		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26943773, 28906590		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22761904		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34576070, 39432990	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26943773, 28906590		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30518874		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21616061, 22988100, 28119353, 29284239, 30893110, 31181641		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27053348	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29866946, 34551773	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29438906		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	28939077	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30334297		★☆☆☆☆ Found in Text Mining only