Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9960
Gene name	Ubiquitin specific peptidase 3
Gene symbol	USP3
Synonyms (NCBI Gene)	SIH003UBP
Chromosome	15
Chromosome location	15q22.31

244

Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027446	hsa-miR-98-5p	Microarray	19088304
MIRT028943	hsa-miR-26b-5p	Microarray	19088304
MIRT047466	hsa-miR-10b-5p	CLASH	23622248
MIRT040763	hsa-miR-18a-3p	CLASH	23622248
MIRT713398	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT713397	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT713396	hsa-miR-337-3p	HITS-CLIP	19536157
MIRT713395	hsa-miR-202-5p	HITS-CLIP	19536157
MIRT713394	hsa-miR-4279	HITS-CLIP	19536157
MIRT713393	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT072572	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT072567	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT072572	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726158	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726157	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726156	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726155	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT072566	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT072575	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT072568	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT072579	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT072567	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT193726	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT028943	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT733051	hsa-miR-455-5p	Luciferase reporter assayqRT-PCRWestern blotting	32918360
MIRT713398	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT713397	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT713396	hsa-miR-337-3p	HITS-CLIP	19536157
MIRT713395	hsa-miR-202-5p	HITS-CLIP	19536157
MIRT713394	hsa-miR-4279	HITS-CLIP	19536157
MIRT713393	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT1479060	hsa-miR-106a	CLIP-seq
MIRT1479061	hsa-miR-106b	CLIP-seq
MIRT1479062	hsa-miR-1297	CLIP-seq
MIRT1479063	hsa-miR-1323	CLIP-seq
MIRT1479064	hsa-miR-15a	CLIP-seq
MIRT1479065	hsa-miR-15b	CLIP-seq
MIRT1479066	hsa-miR-16	CLIP-seq
MIRT1479067	hsa-miR-17	CLIP-seq
MIRT1479068	hsa-miR-195	CLIP-seq
MIRT1479069	hsa-miR-20a	CLIP-seq
MIRT1479070	hsa-miR-20b	CLIP-seq
MIRT1479071	hsa-miR-2116	CLIP-seq
MIRT1479072	hsa-miR-214	CLIP-seq
MIRT1479073	hsa-miR-224	CLIP-seq
MIRT1479074	hsa-miR-26a	CLIP-seq
MIRT1479075	hsa-miR-26b	CLIP-seq
MIRT1479076	hsa-miR-3143	CLIP-seq
MIRT1479077	hsa-miR-3148	CLIP-seq
MIRT1479078	hsa-miR-3163	CLIP-seq
MIRT1479079	hsa-miR-3190	CLIP-seq
MIRT1479080	hsa-miR-3611	CLIP-seq
MIRT1479081	hsa-miR-3619-5p	CLIP-seq
MIRT1479082	hsa-miR-3671	CLIP-seq
MIRT1479083	hsa-miR-424	CLIP-seq
MIRT1479084	hsa-miR-4274	CLIP-seq
MIRT1479085	hsa-miR-4289	CLIP-seq
MIRT1479086	hsa-miR-4291	CLIP-seq
MIRT1479087	hsa-miR-4422	CLIP-seq
MIRT1479088	hsa-miR-4432	CLIP-seq
MIRT1479089	hsa-miR-4465	CLIP-seq
MIRT1479090	hsa-miR-4473	CLIP-seq
MIRT1479091	hsa-miR-4496	CLIP-seq
MIRT1479092	hsa-miR-4641	CLIP-seq
MIRT1479093	hsa-miR-4671-3p	CLIP-seq
MIRT1479094	hsa-miR-4716-5p	CLIP-seq
MIRT1479095	hsa-miR-4752	CLIP-seq
MIRT1479096	hsa-miR-4768-5p	CLIP-seq
MIRT1479097	hsa-miR-4803	CLIP-seq
MIRT1479098	hsa-miR-497	CLIP-seq
MIRT1479099	hsa-miR-499-5p	CLIP-seq
MIRT1479100	hsa-miR-512-3p	CLIP-seq
MIRT1479101	hsa-miR-519a	CLIP-seq
MIRT1479102	hsa-miR-519b-3p	CLIP-seq
MIRT1479103	hsa-miR-519c-3p	CLIP-seq
MIRT1479104	hsa-miR-519d	CLIP-seq
MIRT1479105	hsa-miR-520f	CLIP-seq
MIRT1479106	hsa-miR-545	CLIP-seq
MIRT1479107	hsa-miR-548a-3p	CLIP-seq
MIRT1479108	hsa-miR-548e	CLIP-seq
MIRT1479109	hsa-miR-548f	CLIP-seq
MIRT1479110	hsa-miR-548o	CLIP-seq
MIRT1479111	hsa-miR-548t	CLIP-seq
MIRT1479112	hsa-miR-548u	CLIP-seq
MIRT1479113	hsa-miR-556-3p	CLIP-seq
MIRT1479114	hsa-miR-570	CLIP-seq
MIRT1479115	hsa-miR-600	CLIP-seq
MIRT1479116	hsa-miR-605	CLIP-seq
MIRT1479117	hsa-miR-616	CLIP-seq
MIRT1479118	hsa-miR-619	CLIP-seq
MIRT1479119	hsa-miR-643	CLIP-seq
MIRT1479120	hsa-miR-761	CLIP-seq
MIRT1479121	hsa-miR-875-3p	CLIP-seq
MIRT1479122	hsa-miR-922	CLIP-seq
MIRT1479123	hsa-miR-93	CLIP-seq
MIRT1479060	hsa-miR-106a	CLIP-seq
MIRT1479061	hsa-miR-106b	CLIP-seq
MIRT1479067	hsa-miR-17	CLIP-seq
MIRT1479069	hsa-miR-20a	CLIP-seq
MIRT1479070	hsa-miR-20b	CLIP-seq
MIRT1479101	hsa-miR-519a	CLIP-seq
MIRT1479102	hsa-miR-519b-3p	CLIP-seq
MIRT1479103	hsa-miR-519c-3p	CLIP-seq
MIRT1479104	hsa-miR-519d	CLIP-seq
MIRT1479111	hsa-miR-548t	CLIP-seq
MIRT1479123	hsa-miR-93	CLIP-seq
MIRT2144247	hsa-miR-1257	CLIP-seq
MIRT2144248	hsa-miR-1272	CLIP-seq
MIRT2144249	hsa-miR-1303	CLIP-seq
MIRT2144250	hsa-miR-1322	CLIP-seq
MIRT2144251	hsa-miR-2113	CLIP-seq
MIRT1479072	hsa-miR-214	CLIP-seq
MIRT1479073	hsa-miR-224	CLIP-seq
MIRT2144252	hsa-miR-2964a-5p	CLIP-seq
MIRT2144253	hsa-miR-3065-5p	CLIP-seq
MIRT1479081	hsa-miR-3619-5p	CLIP-seq
MIRT2144254	hsa-miR-362-5p	CLIP-seq
MIRT2144255	hsa-miR-3663-5p	CLIP-seq
MIRT2144256	hsa-miR-3682-3p	CLIP-seq
MIRT2144257	hsa-miR-4259	CLIP-seq
MIRT2144258	hsa-miR-4265	CLIP-seq
MIRT1479084	hsa-miR-4274	CLIP-seq
MIRT1479085	hsa-miR-4289	CLIP-seq
MIRT1479086	hsa-miR-4291	CLIP-seq
MIRT2144259	hsa-miR-4296	CLIP-seq
MIRT2144260	hsa-miR-4322	CLIP-seq
MIRT2144261	hsa-miR-4417	CLIP-seq
MIRT2144262	hsa-miR-4528	CLIP-seq
MIRT2144263	hsa-miR-4640-5p	CLIP-seq
MIRT1479092	hsa-miR-4641	CLIP-seq
MIRT2144264	hsa-miR-4714-3p	CLIP-seq
MIRT2144265	hsa-miR-4715-5p	CLIP-seq
MIRT2144266	hsa-miR-4726-5p	CLIP-seq
MIRT2144267	hsa-miR-500b	CLIP-seq
MIRT1479112	hsa-miR-548u	CLIP-seq
MIRT2144268	hsa-miR-584	CLIP-seq
MIRT2144269	hsa-miR-601	CLIP-seq
MIRT1479117	hsa-miR-616	CLIP-seq
MIRT1479118	hsa-miR-619	CLIP-seq
MIRT1479120	hsa-miR-761	CLIP-seq
MIRT2144270	hsa-miR-885-5p	CLIP-seq
MIRT1479122	hsa-miR-922	CLIP-seq
MIRT2144271	hsa-miR-934	CLIP-seq
MIRT2144247	hsa-miR-1257	CLIP-seq
MIRT2144248	hsa-miR-1272	CLIP-seq
MIRT1479062	hsa-miR-1297	CLIP-seq
MIRT2144249	hsa-miR-1303	CLIP-seq
MIRT1479063	hsa-miR-1323	CLIP-seq
MIRT1479064	hsa-miR-15a	CLIP-seq
MIRT1479065	hsa-miR-15b	CLIP-seq
MIRT1479066	hsa-miR-16	CLIP-seq
MIRT1479068	hsa-miR-195	CLIP-seq
MIRT1479072	hsa-miR-214	CLIP-seq
MIRT1479073	hsa-miR-224	CLIP-seq
MIRT1479074	hsa-miR-26a	CLIP-seq
MIRT1479075	hsa-miR-26b	CLIP-seq
MIRT2144252	hsa-miR-2964a-5p	CLIP-seq
MIRT1479077	hsa-miR-3148	CLIP-seq
MIRT1479079	hsa-miR-3190	CLIP-seq
MIRT2364443	hsa-miR-326	CLIP-seq
MIRT2364444	hsa-miR-330-5p	CLIP-seq
MIRT1479081	hsa-miR-3619-5p	CLIP-seq
MIRT2144254	hsa-miR-362-5p	CLIP-seq
MIRT2144255	hsa-miR-3663-5p	CLIP-seq
MIRT2144256	hsa-miR-3682-3p	CLIP-seq
MIRT2364445	hsa-miR-412	CLIP-seq
MIRT1479083	hsa-miR-424	CLIP-seq
MIRT1479084	hsa-miR-4274	CLIP-seq
MIRT1479086	hsa-miR-4291	CLIP-seq
MIRT1479087	hsa-miR-4422	CLIP-seq
MIRT1479089	hsa-miR-4465	CLIP-seq
MIRT2364446	hsa-miR-4490	CLIP-seq
MIRT2144262	hsa-miR-4528	CLIP-seq
MIRT1479092	hsa-miR-4641	CLIP-seq
MIRT2364447	hsa-miR-4643	CLIP-seq
MIRT2364448	hsa-miR-4663	CLIP-seq
MIRT2364449	hsa-miR-4686	CLIP-seq
MIRT2144264	hsa-miR-4714-3p	CLIP-seq
MIRT1479094	hsa-miR-4716-5p	CLIP-seq
MIRT1479095	hsa-miR-4752	CLIP-seq
MIRT1479096	hsa-miR-4768-5p	CLIP-seq
MIRT2364450	hsa-miR-4774-5p	CLIP-seq
MIRT1479098	hsa-miR-497	CLIP-seq
MIRT2144267	hsa-miR-500b	CLIP-seq
MIRT2364451	hsa-miR-513b	CLIP-seq
MIRT1479106	hsa-miR-545	CLIP-seq
MIRT1479107	hsa-miR-548a-3p	CLIP-seq
MIRT1479108	hsa-miR-548e	CLIP-seq
MIRT1479109	hsa-miR-548f	CLIP-seq
MIRT1479110	hsa-miR-548o	CLIP-seq
MIRT1479113	hsa-miR-556-3p	CLIP-seq
MIRT2144268	hsa-miR-584	CLIP-seq
MIRT2364452	hsa-miR-592	CLIP-seq
MIRT2364453	hsa-miR-599	CLIP-seq
MIRT2144269	hsa-miR-601	CLIP-seq
MIRT1479116	hsa-miR-605	CLIP-seq
MIRT1479118	hsa-miR-619	CLIP-seq
MIRT1479119	hsa-miR-643	CLIP-seq
MIRT1479120	hsa-miR-761	CLIP-seq
MIRT1479121	hsa-miR-875-3p	CLIP-seq
MIRT2144270	hsa-miR-885-5p	CLIP-seq
MIRT1479122	hsa-miR-922	CLIP-seq
MIRT2144271	hsa-miR-934	CLIP-seq
MIRT2364454	hsa-miR-944	CLIP-seq
MIRT2144252	hsa-miR-2964a-5p	CLIP-seq
MIRT2144262	hsa-miR-4528	CLIP-seq
MIRT2144270	hsa-miR-885-5p	CLIP-seq
MIRT1479064	hsa-miR-15a	CLIP-seq
MIRT1479065	hsa-miR-15b	CLIP-seq
MIRT1479066	hsa-miR-16	CLIP-seq
MIRT1479068	hsa-miR-195	CLIP-seq
MIRT1479071	hsa-miR-2116	CLIP-seq
MIRT1479076	hsa-miR-3143	CLIP-seq
MIRT1479078	hsa-miR-3163	CLIP-seq
MIRT2658253	hsa-miR-3171	CLIP-seq
MIRT1479082	hsa-miR-3671	CLIP-seq
MIRT1479083	hsa-miR-424	CLIP-seq
MIRT1479087	hsa-miR-4422	CLIP-seq
MIRT1479088	hsa-miR-4432	CLIP-seq
MIRT2658254	hsa-miR-4452	CLIP-seq
MIRT2658255	hsa-miR-4495	CLIP-seq
MIRT1479097	hsa-miR-4803	CLIP-seq
MIRT1479098	hsa-miR-497	CLIP-seq
MIRT1479099	hsa-miR-499-5p	CLIP-seq
MIRT1479106	hsa-miR-545	CLIP-seq
MIRT2658256	hsa-miR-548c-3p	CLIP-seq
MIRT2658257	hsa-miR-550a	CLIP-seq
MIRT1479113	hsa-miR-556-3p	CLIP-seq
MIRT1479114	hsa-miR-570	CLIP-seq
MIRT1479115	hsa-miR-600	CLIP-seq
MIRT2364454	hsa-miR-944	CLIP-seq
MIRT1479071	hsa-miR-2116	CLIP-seq
MIRT1479076	hsa-miR-3143	CLIP-seq
MIRT1479078	hsa-miR-3163	CLIP-seq
MIRT2658253	hsa-miR-3171	CLIP-seq
MIRT1479082	hsa-miR-3671	CLIP-seq
MIRT1479087	hsa-miR-4422	CLIP-seq
MIRT1479088	hsa-miR-4432	CLIP-seq
MIRT2658255	hsa-miR-4495	CLIP-seq
MIRT1479097	hsa-miR-4803	CLIP-seq
MIRT1479099	hsa-miR-499-5p	CLIP-seq
MIRT2658257	hsa-miR-550a	CLIP-seq
MIRT1479114	hsa-miR-570	CLIP-seq
MIRT1479115	hsa-miR-600	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	17980597
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	17980597
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	10480896
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IMP	17980597
GO:0006325	Process	Chromatin organization	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042393	Function	Histone binding	IPI	17980597
GO:0046872	Function	Metal ion binding	IEA
GO:0090543	Component	Flemming body	IDA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	17980597
GO:0140936	Function	Histone H2B deubiquitinase activity	IMP	17980597
GO:0140950	Function	Histone H2A deubiquitinase activity	IMP	17980597

MIM	HGNC	e!Ensembl
604728	12626	ENSG00000140455

Q9Y6I4

Protein name

Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.4.19.12) (Deubiquitinating enzyme 3) (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3)

Protein function

Deubiquitinase that plays a role in several cellular processes including transcriptional regulation, cell cycle progression or innate immunity. In response to DNA damage, deubiquitinates monoubiquitinated target proteins such as histone H2A and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02148	zf-UBP	29 → 107	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF00443	UCH	159 → 508	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined, with strongest expression in pancreas.

Sequence

MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEG
RWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL

Sequence length

520

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total lymphocyte count	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total neutrophil count	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	38176925	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	31624151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28655924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28655924, 37013584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31056254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34758762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36180571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31266817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31266817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	34917199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31624151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30168892, 31234902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30168892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30168892, 31234902, 31266817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27241213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34536193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30168892, 31234902		★★★★★ ★☆☆☆☆ Found in Text Mining only

USP3 (ubiquitin specific peptidase 3)