Gene Gene information from NCBI Gene database.
Entrez ID 996
Gene name Cell division cycle 27
Gene symbol CDC27
Synonyms (NCBI Gene)
ANAPC3APC3CDC27HsD0S1430ED17S978EH-NUCHNUCNUC2
Chromosome 17
Chromosome location 17q21.32
Summary The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight
miRNA miRNA information provided by mirtarbase database.
576
miRTarBase ID miRNA Experiments Reference
MIRT022384 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT028274 hsa-miR-32-5p Sequencing 20371350
MIRT031584 hsa-miR-16-5p Sequencing 20371350
MIRT438228 hsa-miR-223-3p Luciferase reporter assay 24324762
MIRT438228 hsa-miR-223-3p Luciferase reporter assay 24324762
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10548110, 16648845, 17443180, 17443186, 17474147, 17719540, 18662541, 20212161, 20360068, 20439707, 20802534, 20951947, 21186364, 21241890, 21300909, 21772247, 22014574, 23708001, 24781523, 25383541, 25416956, 25609649, 26083744, 26496610, 33961781, 35271311
GO:0005634 Component Nucleus IDA 18445686, 21241890
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
116946 1728 ENSG00000004897
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P30260
Protein name Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)
Protein function Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit
PDB 3T1N , 4RG6 , 4RG7 , 4RG9 , 4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9FGQ , 9GAW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12895 ANAPC3 17 95 Domain
PF00515 TPR_1 567 600 Tetratricopeptide repeat Repeat
PF00515 TPR_1 635 668 Tetratricopeptide repeat Repeat
Sequence
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGG
VFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTP
QVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQS
SVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
Sequence length 824
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Human T-cell leukemia virus 1 infection
  Inactivation of APC/C via direct inhibition of the APC/C complex
APC/C:Cdc20 mediated degradation of Cyclin B
Autodegradation of Cdh1 by Cdh1:APC/C
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
APC/C:Cdc20 mediated degradation of mitotic proteins
Phosphorylation of the APC/C
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Senescence-Associated Secretory Phenotype (SASP)
CDK-mediated phosphorylation and removal of Cdc6
Transcriptional Regulation by VENTX
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Pulmonary artery atresia Pathogenic rs775321736 RCV002512185
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL ATRESIA OF PULMONARY ARTERY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Esophageal atresia Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
ESSENTIAL HYPERTENSION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 25490274 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 23755904, 25680405, 27102006
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25680405 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 25490274, 30012096 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 25912578 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 26821069, 28900500
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Diabetes mellitus, type 1 Pubtator 33029194 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 30012096 Associate
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 35418986 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 23755904, 25680405, 27102006
★☆☆☆☆
Found in Text Mining only