Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9958
Gene name	Ubiquitin specific peptidase 15
Gene symbol	USP15
Synonyms (NCBI Gene)	UNPH-2UNPH4
Chromosome	12
Chromosome location	12q14.1
Summary	This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. T

338

Show/Hide all (338)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027211	hsa-miR-103a-3p	Sequencing	20371350
MIRT031860	hsa-miR-16-5p	Sequencing	20371350
MIRT032405	hsa-let-7b-5p	Proteomics	18668040
MIRT046709	hsa-miR-222-3p	CLASH	23622248
MIRT045575	hsa-miR-149-5p	CLASH	23622248
MIRT697767	hsa-miR-4668-3p	HITS-CLIP	23313552
MIRT697768	hsa-miR-541-5p	HITS-CLIP	23313552
MIRT686373	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686372	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686371	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686370	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686369	hsa-miR-302e	HITS-CLIP	23313552
MIRT686368	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686367	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686366	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686365	hsa-miR-520b	HITS-CLIP	23313552
MIRT686364	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686363	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686362	hsa-miR-520e	HITS-CLIP	23313552
MIRT686361	hsa-miR-4438	HITS-CLIP	23313552
MIRT686360	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686359	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686358	hsa-miR-520h	HITS-CLIP	23313552
MIRT686357	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686356	hsa-miR-6078	HITS-CLIP	23313552
MIRT686355	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT686354	hsa-miR-532-3p	HITS-CLIP	23313552
MIRT686353	hsa-miR-2116-3p	HITS-CLIP	23313552
MIRT686352	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686351	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT686350	hsa-miR-924	HITS-CLIP	23313552
MIRT686349	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686348	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686347	hsa-miR-5095	HITS-CLIP	23313552
MIRT686346	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686345	hsa-miR-4713-5p	HITS-CLIP	23313552
MIRT686344	hsa-miR-627-5p	HITS-CLIP	23313552
MIRT686343	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT066314	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT066312	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT066313	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031860	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT066316	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT066317	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT066323	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT571579	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT066329	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT066325	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT066334	hsa-miR-5584-5p	PAR-CLIP	20371350
MIRT066326	hsa-miR-105-5p	PAR-CLIP	20371350
MIRT066335	hsa-miR-7853-5p	PAR-CLIP	20371350
MIRT066318	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT066331	hsa-miR-3148	PAR-CLIP	20371350
MIRT066333	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT571578	hsa-miR-3671	PAR-CLIP	20371350
MIRT066328	hsa-miR-607	PAR-CLIP	20371350
MIRT734077	hsa-miR-202-5p	Luciferase reporter assayWestern blottingImmunofluorescenceChIP-seqqRT-PCRIn situ hybridization	31952546
MIRT697767	hsa-miR-4668-3p	HITS-CLIP	23313552
MIRT697768	hsa-miR-541-5p	HITS-CLIP	23313552
MIRT686373	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686372	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686371	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686370	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686369	hsa-miR-302e	HITS-CLIP	23313552
MIRT686368	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686367	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686366	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686365	hsa-miR-520b	HITS-CLIP	23313552
MIRT686364	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686363	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686362	hsa-miR-520e	HITS-CLIP	23313552
MIRT686361	hsa-miR-4438	HITS-CLIP	23313552
MIRT686360	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686359	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686358	hsa-miR-520h	HITS-CLIP	23313552
MIRT686357	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686356	hsa-miR-6078	HITS-CLIP	23313552
MIRT686355	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT686354	hsa-miR-532-3p	HITS-CLIP	23313552
MIRT686353	hsa-miR-2116-3p	HITS-CLIP	23313552
MIRT686352	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686351	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT686350	hsa-miR-924	HITS-CLIP	23313552
MIRT686349	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686348	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686347	hsa-miR-5095	HITS-CLIP	23313552
MIRT686346	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686345	hsa-miR-4713-5p	HITS-CLIP	23313552
MIRT686344	hsa-miR-627-5p	HITS-CLIP	23313552
MIRT686343	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT066314	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT066312	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT066313	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031860	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT066316	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT066317	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT066323	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT571579	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT066329	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT066325	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT066334	hsa-miR-5584-5p	PAR-CLIP	20371350
MIRT066326	hsa-miR-105-5p	PAR-CLIP	20371350
MIRT066335	hsa-miR-7853-5p	PAR-CLIP	20371350
MIRT066318	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT066331	hsa-miR-3148	PAR-CLIP	20371350
MIRT066333	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT571578	hsa-miR-3671	PAR-CLIP	20371350
MIRT066328	hsa-miR-607	PAR-CLIP	20371350
MIRT756226	hsa-miR-100-5p	Luciferase reporter assayWestern blottingqRT-PCR	36714373
MIRT1477804	hsa-miR-1266	CLIP-seq
MIRT1477805	hsa-miR-1278	CLIP-seq
MIRT1477806	hsa-miR-1297	CLIP-seq
MIRT1477807	hsa-miR-1302	CLIP-seq
MIRT1477808	hsa-miR-132	CLIP-seq
MIRT1477809	hsa-miR-1323	CLIP-seq
MIRT1477810	hsa-miR-140-3p	CLIP-seq
MIRT1477811	hsa-miR-15a	CLIP-seq
MIRT1477812	hsa-miR-15b	CLIP-seq
MIRT1477813	hsa-miR-16	CLIP-seq
MIRT1477814	hsa-miR-195	CLIP-seq
MIRT1477815	hsa-miR-196a	CLIP-seq
MIRT1477816	hsa-miR-196b	CLIP-seq
MIRT1477817	hsa-miR-212	CLIP-seq
MIRT1477818	hsa-miR-217	CLIP-seq
MIRT1477819	hsa-miR-26a	CLIP-seq
MIRT1477820	hsa-miR-26b	CLIP-seq
MIRT1477821	hsa-miR-300	CLIP-seq
MIRT1477822	hsa-miR-3189-5p	CLIP-seq
MIRT1477823	hsa-miR-330-3p	CLIP-seq
MIRT1477824	hsa-miR-338-3p	CLIP-seq
MIRT1477825	hsa-miR-3607-3p	CLIP-seq
MIRT1477826	hsa-miR-3664-3p	CLIP-seq
MIRT1477827	hsa-miR-3670	CLIP-seq
MIRT1477828	hsa-miR-381	CLIP-seq
MIRT1477829	hsa-miR-410	CLIP-seq
MIRT1477830	hsa-miR-424	CLIP-seq
MIRT1477831	hsa-miR-4261	CLIP-seq
MIRT1477832	hsa-miR-4298	CLIP-seq
MIRT1477833	hsa-miR-4310	CLIP-seq
MIRT1477834	hsa-miR-4418	CLIP-seq
MIRT1477835	hsa-miR-4453	CLIP-seq
MIRT1477836	hsa-miR-4464	CLIP-seq
MIRT1477837	hsa-miR-4465	CLIP-seq
MIRT1477838	hsa-miR-4496	CLIP-seq
MIRT1477839	hsa-miR-4518	CLIP-seq
MIRT1477840	hsa-miR-4538	CLIP-seq
MIRT1477841	hsa-miR-455-5p	CLIP-seq
MIRT1477842	hsa-miR-4648	CLIP-seq
MIRT1477843	hsa-miR-4698	CLIP-seq
MIRT1477844	hsa-miR-4748	CLIP-seq
MIRT1477845	hsa-miR-4758-3p	CLIP-seq
MIRT1477846	hsa-miR-4803	CLIP-seq
MIRT1477847	hsa-miR-494	CLIP-seq
MIRT1477848	hsa-miR-497	CLIP-seq
MIRT1477849	hsa-miR-509-3-5p	CLIP-seq
MIRT1477850	hsa-miR-509-5p	CLIP-seq
MIRT1477851	hsa-miR-545	CLIP-seq
MIRT1477852	hsa-miR-548o	CLIP-seq
MIRT1477853	hsa-miR-758	CLIP-seq
MIRT2143943	hsa-miR-1226	CLIP-seq
MIRT2143944	hsa-miR-135a	CLIP-seq
MIRT2143945	hsa-miR-135b	CLIP-seq
MIRT2143946	hsa-miR-214	CLIP-seq
MIRT1477818	hsa-miR-217	CLIP-seq
MIRT2143947	hsa-miR-338-5p	CLIP-seq
MIRT2143948	hsa-miR-3619-5p	CLIP-seq
MIRT1477834	hsa-miR-4418	CLIP-seq
MIRT2143949	hsa-miR-4530	CLIP-seq
MIRT2143950	hsa-miR-4753-3p	CLIP-seq
MIRT1477849	hsa-miR-509-3-5p	CLIP-seq
MIRT1477850	hsa-miR-509-5p	CLIP-seq
MIRT2143951	hsa-miR-593	CLIP-seq
MIRT2143952	hsa-miR-634	CLIP-seq
MIRT2143953	hsa-miR-761	CLIP-seq
MIRT2364167	hsa-miR-1184	CLIP-seq
MIRT2143943	hsa-miR-1226	CLIP-seq
MIRT1477805	hsa-miR-1278	CLIP-seq
MIRT1477806	hsa-miR-1297	CLIP-seq
MIRT2364168	hsa-miR-1301	CLIP-seq
MIRT1477809	hsa-miR-1323	CLIP-seq
MIRT2143944	hsa-miR-135a	CLIP-seq
MIRT2143945	hsa-miR-135b	CLIP-seq
MIRT1477811	hsa-miR-15a	CLIP-seq
MIRT1477812	hsa-miR-15b	CLIP-seq
MIRT1477813	hsa-miR-16	CLIP-seq
MIRT1477814	hsa-miR-195	CLIP-seq
MIRT2143946	hsa-miR-214	CLIP-seq
MIRT1477818	hsa-miR-217	CLIP-seq
MIRT1477819	hsa-miR-26a	CLIP-seq
MIRT1477820	hsa-miR-26b	CLIP-seq
MIRT2143948	hsa-miR-3619-5p	CLIP-seq
MIRT1477830	hsa-miR-424	CLIP-seq
MIRT2364169	hsa-miR-4289	CLIP-seq
MIRT2364170	hsa-miR-4330	CLIP-seq
MIRT1477834	hsa-miR-4418	CLIP-seq
MIRT1477837	hsa-miR-4465	CLIP-seq
MIRT2364171	hsa-miR-4494	CLIP-seq
MIRT2143949	hsa-miR-4530	CLIP-seq
MIRT2364172	hsa-miR-4660	CLIP-seq
MIRT2143950	hsa-miR-4753-3p	CLIP-seq
MIRT2364173	hsa-miR-487a	CLIP-seq
MIRT1477848	hsa-miR-497	CLIP-seq
MIRT2364174	hsa-miR-499a-5p	CLIP-seq
MIRT2364175	hsa-miR-5047	CLIP-seq
MIRT1477849	hsa-miR-509-3-5p	CLIP-seq
MIRT1477850	hsa-miR-509-5p	CLIP-seq
MIRT2364176	hsa-miR-541	CLIP-seq
MIRT1477851	hsa-miR-545	CLIP-seq
MIRT1477852	hsa-miR-548o	CLIP-seq
MIRT2364177	hsa-miR-555	CLIP-seq
MIRT2364178	hsa-miR-587	CLIP-seq
MIRT2143951	hsa-miR-593	CLIP-seq
MIRT2143952	hsa-miR-634	CLIP-seq
MIRT2364179	hsa-miR-654-5p	CLIP-seq
MIRT2143953	hsa-miR-761	CLIP-seq
MIRT2396731	hsa-miR-362-5p	CLIP-seq
MIRT2396732	hsa-miR-3690	CLIP-seq
MIRT2396733	hsa-miR-4254	CLIP-seq
MIRT2396734	hsa-miR-4642	CLIP-seq
MIRT2396735	hsa-miR-4793-5p	CLIP-seq
MIRT2396736	hsa-miR-500b	CLIP-seq
MIRT2463012	hsa-miR-3150a-5p	CLIP-seq
MIRT2463013	hsa-miR-3150b-5p	CLIP-seq
MIRT2463014	hsa-miR-4282	CLIP-seq
MIRT2463015	hsa-miR-590-3p	CLIP-seq
MIRT2657874	hsa-miR-105	CLIP-seq
MIRT2364167	hsa-miR-1184	CLIP-seq
MIRT2143943	hsa-miR-1226	CLIP-seq
MIRT2657875	hsa-miR-1237	CLIP-seq
MIRT2657876	hsa-miR-1244	CLIP-seq
MIRT2657877	hsa-miR-1299	CLIP-seq
MIRT2364168	hsa-miR-1301	CLIP-seq
MIRT2143944	hsa-miR-135a	CLIP-seq
MIRT2143945	hsa-miR-135b	CLIP-seq
MIRT1477811	hsa-miR-15a	CLIP-seq
MIRT1477812	hsa-miR-15b	CLIP-seq
MIRT1477813	hsa-miR-16	CLIP-seq
MIRT1477814	hsa-miR-195	CLIP-seq
MIRT2143946	hsa-miR-214	CLIP-seq
MIRT1477818	hsa-miR-217	CLIP-seq
MIRT2657878	hsa-miR-28-3p	CLIP-seq
MIRT2657879	hsa-miR-3157-5p	CLIP-seq
MIRT2657880	hsa-miR-3200-5p	CLIP-seq
MIRT2657881	hsa-miR-320a	CLIP-seq
MIRT2657882	hsa-miR-320b	CLIP-seq
MIRT2657883	hsa-miR-320c	CLIP-seq
MIRT2657884	hsa-miR-320d	CLIP-seq
MIRT2657885	hsa-miR-3613-3p	CLIP-seq
MIRT2143948	hsa-miR-3619-5p	CLIP-seq
MIRT1477830	hsa-miR-424	CLIP-seq
MIRT2657886	hsa-miR-4251	CLIP-seq
MIRT2657887	hsa-miR-4303	CLIP-seq
MIRT2657888	hsa-miR-4307	CLIP-seq
MIRT2657889	hsa-miR-4329	CLIP-seq
MIRT2364170	hsa-miR-4330	CLIP-seq
MIRT1477834	hsa-miR-4418	CLIP-seq
MIRT2657890	hsa-miR-4422	CLIP-seq
MIRT2657891	hsa-miR-4429	CLIP-seq
MIRT2657892	hsa-miR-4452	CLIP-seq
MIRT2364171	hsa-miR-4494	CLIP-seq
MIRT2657893	hsa-miR-4522	CLIP-seq
MIRT2143949	hsa-miR-4530	CLIP-seq
MIRT2364172	hsa-miR-4660	CLIP-seq
MIRT2657894	hsa-miR-4691-3p	CLIP-seq
MIRT2657895	hsa-miR-4724-3p	CLIP-seq
MIRT2657896	hsa-miR-4738-3p	CLIP-seq
MIRT2143950	hsa-miR-4753-3p	CLIP-seq
MIRT2657897	hsa-miR-4768-5p	CLIP-seq
MIRT2364173	hsa-miR-487a	CLIP-seq
MIRT1477848	hsa-miR-497	CLIP-seq
MIRT2364174	hsa-miR-499a-5p	CLIP-seq
MIRT2364175	hsa-miR-5047	CLIP-seq
MIRT1477849	hsa-miR-509-3-5p	CLIP-seq
MIRT1477850	hsa-miR-509-5p	CLIP-seq
MIRT2657898	hsa-miR-539	CLIP-seq
MIRT2364176	hsa-miR-541	CLIP-seq
MIRT1477851	hsa-miR-545	CLIP-seq
MIRT2657899	hsa-miR-548ae	CLIP-seq
MIRT2657900	hsa-miR-548aj	CLIP-seq
MIRT2657901	hsa-miR-548al	CLIP-seq
MIRT2657902	hsa-miR-548am	CLIP-seq
MIRT2657903	hsa-miR-548p	CLIP-seq
MIRT2657904	hsa-miR-548x	CLIP-seq
MIRT2364177	hsa-miR-555	CLIP-seq
MIRT2657905	hsa-miR-586	CLIP-seq
MIRT2364178	hsa-miR-587	CLIP-seq
MIRT2143951	hsa-miR-593	CLIP-seq
MIRT2143952	hsa-miR-634	CLIP-seq
MIRT2364179	hsa-miR-654-5p	CLIP-seq
MIRT2143953	hsa-miR-761	CLIP-seq
MIRT2657906	hsa-miR-873	CLIP-seq
MIRT2657907	hsa-miR-875-3p	CLIP-seq
MIRT2657874	hsa-miR-105	CLIP-seq
MIRT2364167	hsa-miR-1184	CLIP-seq
MIRT2143943	hsa-miR-1226	CLIP-seq
MIRT2657875	hsa-miR-1237	CLIP-seq
MIRT2657876	hsa-miR-1244	CLIP-seq
MIRT2657877	hsa-miR-1299	CLIP-seq
MIRT2364168	hsa-miR-1301	CLIP-seq
MIRT2143946	hsa-miR-214	CLIP-seq
MIRT1477818	hsa-miR-217	CLIP-seq
MIRT2657878	hsa-miR-28-3p	CLIP-seq
MIRT2657881	hsa-miR-320a	CLIP-seq
MIRT2657882	hsa-miR-320b	CLIP-seq
MIRT2657883	hsa-miR-320c	CLIP-seq
MIRT2657884	hsa-miR-320d	CLIP-seq
MIRT2143948	hsa-miR-3619-5p	CLIP-seq
MIRT2657886	hsa-miR-4251	CLIP-seq
MIRT2657887	hsa-miR-4303	CLIP-seq
MIRT2657889	hsa-miR-4329	CLIP-seq
MIRT2364170	hsa-miR-4330	CLIP-seq
MIRT1477834	hsa-miR-4418	CLIP-seq
MIRT2657891	hsa-miR-4429	CLIP-seq
MIRT2657892	hsa-miR-4452	CLIP-seq
MIRT2364171	hsa-miR-4494	CLIP-seq
MIRT2657893	hsa-miR-4522	CLIP-seq
MIRT2143949	hsa-miR-4530	CLIP-seq
MIRT2364172	hsa-miR-4660	CLIP-seq
MIRT2657895	hsa-miR-4724-3p	CLIP-seq
MIRT2657896	hsa-miR-4738-3p	CLIP-seq
MIRT2143950	hsa-miR-4753-3p	CLIP-seq
MIRT2657897	hsa-miR-4768-5p	CLIP-seq
MIRT2364173	hsa-miR-487a	CLIP-seq
MIRT2364174	hsa-miR-499a-5p	CLIP-seq
MIRT2364175	hsa-miR-5047	CLIP-seq
MIRT1477849	hsa-miR-509-3-5p	CLIP-seq
MIRT1477850	hsa-miR-509-5p	CLIP-seq
MIRT2657898	hsa-miR-539	CLIP-seq
MIRT2364176	hsa-miR-541	CLIP-seq
MIRT2657901	hsa-miR-548al	CLIP-seq
MIRT2364177	hsa-miR-555	CLIP-seq
MIRT2364178	hsa-miR-587	CLIP-seq
MIRT2143951	hsa-miR-593	CLIP-seq
MIRT2143952	hsa-miR-634	CLIP-seq
MIRT2364179	hsa-miR-654-5p	CLIP-seq
MIRT2143953	hsa-miR-761	CLIP-seq
MIRT2657906	hsa-miR-873	CLIP-seq
MIRT2657907	hsa-miR-875-3p	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	21947082, 22344298
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	9827704
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	16005295, 21947082, 22344298, 24526689, 27368102, 33093067
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	10444327
GO:0005160	Function	Transforming growth factor beta receptor binding	IPI	22344298
GO:0005515	Function	Protein binding	IPI	21209336, 21750715, 24526689, 25416956, 27368102, 31477895, 31515488, 32101751, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21947082, 24526689
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21947082, 24526689
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	21947082
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IDA	16005295, 27368102
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030509	Process	BMP signaling pathway	IDA	21947082
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	22344298
GO:0035520	Process	Monoubiquitinated protein deubiquitination	IDA	21947082, 24399297
GO:0042802	Function	Identical protein binding	IPI	22001210
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11053425, 18223652, 18287044
GO:0046332	Function	SMAD binding	IPI	21947082, 22344298
GO:0051252	Process	Regulation of RNA metabolic process	IDA	32839293
GO:0051252	Process	Regulation of RNA metabolic process	IDA	32839293
GO:0061649	Function	Ubiquitin-modified histone reader activity	IDA	24526689
GO:0101005	Function	Deubiquitinase activity	IDA	32839293
GO:0101005	Function	Deubiquitinase activity	IEA
GO:0140673	Process	Transcription elongation-coupled chromatin remodeling	IBA
GO:0140673	Process	Transcription elongation-coupled chromatin remodeling	IDA	24526689
GO:1900246	Process	Positive regulation of RIG-I signaling pathway	IDA	24399297
GO:1902238	Process	Regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator	IEA
GO:1905035	Process	Negative regulation of antifungal innate immune response	IDA	33093067
GO:1990167	Process	Protein K27-linked deubiquitination	IDA	33093067
GO:1990380	Function	K48-linked deubiquitinase activity	IDA	24399297

MIM	HGNC	e!Ensembl
604731	12613	ENSG00000135655

Q9Y4E8

Protein name

Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Unph-2) (Unph4)

Protein function

Hydrolase that removes conjugated ubiquitin from target proteins and regulates various pathways such as the TGF-beta receptor signaling, NF-kappa-B and RNF41/NRDP1-PRKN pathways (PubMed:16005295, PubMed:17318178, PubMed:19576224, PubMed:19826004

PDB

1W6V , 3LMN , 3PPA , 3PV1 , 3T9L , 4A3O , 4A3P , 5JJW , 6CPM , 6CRN , 6DJ9 , 6GH9 , 6GHA , 6ML1 , 7R2G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06337	DUSP	27 → 119	DUSP domain	Domain
PF14836	Ubiquitin_3	135 → 222	Ubiquitin-like domain	Domain
PF00443	UCH	289 → 930	Ubiquitin carboxyl-terminal hydrolase	Family
PF14533	USP7_C2	461 → 607	Ubiquitin-specific protease C-terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues.

Sequence

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYL
VRMDPLTKPMQYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENL
SSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRN
NTEDKLYNLLLLRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQLTGHKKRLFTFQFNNLG
NTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKP
PKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLE
SDEDSNDNDNDIENENCMHTN

Sequence length

981

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USP15-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorder	Autism	Pubtator	28344757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33771975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33267707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27060135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	21219870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37227305, 37743483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Axonal Neuropathy	Giant axonal neuropathy	Pubtator	37903270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22344298, 23613489, 29299163, 29467901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22344298, 23613489, 29299163, 29467901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29467901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24487271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33267707	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35422093	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34326621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23613489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28126338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24777531, 29429988, 30459344, 30874560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28276505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	28276505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28276505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30459344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34583995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37373211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21219870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23613489, 24777531, 29299163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30181549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29593334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23613489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24852371, 28245560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28126338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40413536	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	24487271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34326621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36606578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP15 (ubiquitin specific peptidase 15)