Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9953
Gene name	Heparan sulfate-glucosamine 3-sulfotransferase 3B1
Gene symbol	HS3ST3B1
Synonyms (NCBI Gene)	3-OST-3B3OST3B1h3-OST-3B
Chromosome	17
Chromosome location	17p12
Summary	The protein encoded by this gene is a type II integral membrane protein that belongs to the 3-O-sulfotransferases family. These proteins catalyze the addition of sulfate groups at the 3-OH position of glucosamine in heparan sulfate. The substrate specific

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026649	hsa-miR-192-5p	Microarray	19074876
MIRT030947	hsa-miR-21-5p	Sequencing	20371350
MIRT657278	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657277	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT657276	hsa-miR-548ax	HITS-CLIP	23824327
MIRT657274	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT657275	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT657273	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657272	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT657271	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT506948	hsa-miR-132-3p	PAR-CLIP	22012620
MIRT506947	hsa-miR-212-3p	PAR-CLIP	22012620
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	22012620
MIRT506945	hsa-miR-4477a	PAR-CLIP	22012620
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506947	hsa-miR-212-3p	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506945	hsa-miR-4477a	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	26701625
MIRT506948	hsa-miR-132-3p	PAR-CLIP	27292025
MIRT506947	hsa-miR-212-3p	PAR-CLIP	27292025
MIRT506945	hsa-miR-4477a	PAR-CLIP	27292025
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	27292025
MIRT657278	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657277	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT657276	hsa-miR-548ax	HITS-CLIP	23824327
MIRT657274	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT657275	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT657273	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657272	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT657271	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT506948	hsa-miR-132-3p	PAR-CLIP	22012620
MIRT506947	hsa-miR-212-3p	PAR-CLIP	22012620
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	22012620
MIRT506945	hsa-miR-4477a	PAR-CLIP	22012620
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT506948	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT506947	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT506946	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT506945	hsa-miR-4477a	PAR-CLIP	23446348
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054939	hsa-miR-146a	CLIP-seq
MIRT1054940	hsa-miR-146b-5p	CLIP-seq
MIRT1054941	hsa-miR-1827	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054943	hsa-miR-216a	CLIP-seq
MIRT1054944	hsa-miR-216b	CLIP-seq
MIRT1054945	hsa-miR-3173-3p	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054947	hsa-miR-3612	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT1054949	hsa-miR-3686	CLIP-seq
MIRT1054950	hsa-miR-4434	CLIP-seq
MIRT1054951	hsa-miR-4516	CLIP-seq
MIRT1054952	hsa-miR-4531	CLIP-seq
MIRT1054953	hsa-miR-4652-3p	CLIP-seq
MIRT1054954	hsa-miR-4695-5p	CLIP-seq
MIRT1054955	hsa-miR-577	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054957	hsa-miR-650	CLIP-seq
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054938	hsa-miR-1	CLIP-seq
MIRT1054941	hsa-miR-1827	CLIP-seq
MIRT1054942	hsa-miR-206	CLIP-seq
MIRT1054945	hsa-miR-3173-3p	CLIP-seq
MIRT1054946	hsa-miR-320e	CLIP-seq
MIRT1054947	hsa-miR-3612	CLIP-seq
MIRT1054948	hsa-miR-3673	CLIP-seq
MIRT2244830	hsa-miR-4514	CLIP-seq
MIRT2244831	hsa-miR-4692	CLIP-seq
MIRT1054954	hsa-miR-4695-5p	CLIP-seq
MIRT1054956	hsa-miR-613	CLIP-seq
MIRT1054957	hsa-miR-650	CLIP-seq
MIRT2244832	hsa-miR-940	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9988767
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IDA	9988768
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IBA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IDA	9988768
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	IEA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase activity	TAS	9988767
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IEA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	TAS	9988767, 9988768
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA

MIM	HGNC	e!Ensembl
604058	5198	ENSG00000125430

Q9Y662

Protein name

Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 (EC 2.8.2.30) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1) (3-OST-3B) (Heparan sulfate 3-O-sulfotransferase 3B1) (h3-OST-3B)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate (PubMed:10520990, PubMed:9988768). Catal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	137 → 384	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Most abundant in liver and placenta, followed by heart and kidney. {ECO:0000269|PubMed:9988767}.

Sequence

MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPG
LLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPD
SPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
LAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQ
TLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
DREVVRRLREFYRPFNLKFYQMTGHDFGWD

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - heparan sulfate / heparin		HS-GAG biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL CORNEAL DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS' ENDOTHELIAL DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30984249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30360368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12819009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30984249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	20705311	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36246561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25536282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30360368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21709440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30984249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29516954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21709440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21709440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HS3ST3B1 (heparan sulfate-glucosamine 3-sulfotransferase 3B1)