ARHGAP25 (Rho GTPase activating protein 25)

Gene

• Entrez ID: 9938
• Gene name: Rho GTPase activating protein 25
• Gene symbol: ARHGAP25
• Synonyms (NCBI Gene): HEL-S-308, KAIA0053
• Chromosome: 2
• Chromosome location: 2p13.3
• Summary: ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM, Mar 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001891	Component	Phagocytic cup	IBA
GO:0001891	Component	Phagocytic cup	IDA	26465210
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0006911	Process	Phagocytosis, engulfment	IBA
GO:0006911	Process	Phagocytosis, engulfment	IMP	26465210
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IMP	26465210
GO:0007165	Process	Signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IBA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IMP	26465210

Other IDs

• MIM: 610587
• HGNC: 28951
• e!Ensembl: ENSG00000163219

Protein

• UniProt ID: P42331
• Protein name: Rho GTPase-activating protein 25 (Rho-type GTPase-activating protein 25)
• Protein function: GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
• PDB: 1V89
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	47 → 151	PH domain	Domain
  PF00620	RhoGAP	177 → 329	RhoGAP domain	Domain

• Sequence:

  MSLKLPRNWDFNLKVEAAKIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIV
  KNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWD
  QNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGVFGQRLDETVAYEQKFGPHLVPILV
  EKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLR
  DLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQL
  NCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIP
  LSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPED
  SSKVPREKPGDWKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAGE
  GHRRTMSQDLRQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNSETGP
  GKKNSGEEEIDSLQRMVQELRKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKEK
  KKSAALEISLRNMERSREDVEKRNKALEEEVKEFVKSMKEPKTEA

• Sequence length: 645

Pathways

Reactome:

Rho GTPase cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27413008		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39210013	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31692494		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35971449	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31169325, 31228451		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30942443	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30942443		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	39210013	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31692494		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37465666	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	27413008	Associate	★☆☆☆☆ Found in Text Mining only