Gene Gene information from NCBI Gene database.
Entrez ID 9936
Gene name CD302 molecule
Gene symbol CD302
Synonyms (NCBI Gene)
BIMLECCLEC13ADCL-1DCL1
Chromosome 2
Chromosome location 2q24.2
Summary CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008]
miRNA miRNA information provided by mirtarbase database.
375
miRTarBase ID miRNA Experiments Reference
MIRT050420 hsa-miR-23a-3p CLASH 23622248
MIRT046309 hsa-miR-23b-3p CLASH 23622248
MIRT875018 hsa-miR-1270 CLIP-seq
MIRT875019 hsa-miR-1273e CLIP-seq
MIRT875020 hsa-miR-1827 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005902 Component Microvillus IEA
GO:0005938 Component Cell cortex IDA 17947679
GO:0005938 Component Cell cortex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612246 30843 ENSG00000241399
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IX05
Protein name CD302 antigen (C-type lectin BIMLEC) (C-type lectin domain family 13 member A) (DEC205-associated C-type lectin 1) (Type I transmembrane C-type lectin receptor DCL-1) (CD antigen CD302)
Protein function Potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
PDB 2NAN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 45 155 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at moderate levels in monocytes, myeloid blood dendritic cells and granulocytes and at low levels in plasmacytoid blood dendritic cells, monocyte-derived ma crophages and monocyte-derived dendritic cells, with no expression d
Sequence
MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHG
ADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD
DEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKT
AIPYKRKYLSDNHILISALVIASTV
ILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFD
Sequence length 232
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPOTHYROIDISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Carcinoma BEFREE 16533763
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 20165882 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 20849603 Associate
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Hodgkin Disease LHGDN 12824192
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Hodgkin disease Pubtator 12824192 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia BEFREE 31075107
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 20849603 Associate
★☆☆☆☆
Found in Text Mining only
Neuroendocrine Tumors Neuroendocrine Tumors BEFREE 25098566
★☆☆☆☆
Found in Text Mining only
Prostate carcinoma Prostate cancer BEFREE 16533763
★☆☆☆☆
Found in Text Mining only
Trigeminal Neuralgia Trigeminal neuralgia Pubtator 38158702 Associate
★☆☆☆☆
Found in Text Mining only