CDC25A (cell division cycle 25A)

Gene

• Entrez ID: 993
• Gene name: Cell division cycle 25A
• Gene symbol: CDC25A
• Synonyms (NCBI Gene): CDC25A2
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in respons

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001011	hsa-miR-34a-5p	Western blot	18406353
MIRT000655	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT000648	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT000284	hsa-miR-15a-5p	Luciferase reporter assay	18949056
MIRT003186	hsa-miR-449a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19833767
MIRT002296	hsa-let-7b-5p	Immunohistochemistry, qRT-PCR	19966857
MIRT002296	hsa-let-7b-5p	Luciferase reporter assay, Microarray, Western blot	17699775
MIRT000157	hsa-miR-21-5p	Microarray, Northern blot, qRT-PCR	19826040
MIRT000157	hsa-miR-21-5p	Microarray, Northern blot, qRT-PCR	19826040
MIRT000157	hsa-miR-21-5p	Luciferase reporter assay	23496142
MIRT016138	hsa-miR-449b-5p	Reporter assay;Western blot	19833767
MIRT016313	hsa-miR-193b-3p	Microarray	20304954
MIRT003186	hsa-miR-449a	Reporter assay;Western blot;Other	19833767
MIRT026127	hsa-miR-192-5p	Microarray	19074876
MIRT027018	hsa-miR-103a-3p	Sequencing	20371350
MIRT027421	hsa-miR-98-5p	Microarray	19088304
MIRT000157	hsa-miR-21-5p	Microarray	18591254
MIRT031451	hsa-miR-16-5p	Sequencing	20371350
MIRT049120	hsa-miR-92a-3p	CLASH	23622248
MIRT046546	hsa-let-7i-5p	CLASH	23622248
MIRT041718	hsa-miR-484	CLASH	23622248
MIRT040942	hsa-miR-18a-3p	CLASH	23622248
MIRT036976	hsa-miR-877-3p	CLASH	23622248
MIRT053583	hsa-miR-365a-3p	Flow, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24149576
MIRT054799	hsa-miR-141-3p	Luciferase reporter assay, Immunoblot, Western blot	24937190
MIRT437792	hsa-miR-195-5p	Luciferase reporter assay, Western blot	23544130
MIRT437797	hsa-miR-497-5p	Luciferase reporter assay, Western blot	23544130
MIRT003186	hsa-miR-449a	Luciferase reporter assay	23590309
MIRT479631	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT000284	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT031451	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT437797	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT437792	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT000655	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479630	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT000648	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT479629	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT479628	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT479627	hsa-miR-4323	PAR-CLIP	23592263
MIRT479626	hsa-miR-624-5p	PAR-CLIP	23592263
MIRT479625	hsa-miR-5584-3p	PAR-CLIP	23592263
MIRT162603	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT479624	hsa-miR-4712-5p	PAR-CLIP	23592263
MIRT479623	hsa-miR-770-5p	PAR-CLIP	23592263
MIRT479622	hsa-miR-1281	PAR-CLIP	23592263
MIRT479620	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT479621	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT479619	hsa-miR-668-5p	PAR-CLIP	23592263
MIRT479618	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT479617	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT479616	hsa-miR-4803	PAR-CLIP	23592263
MIRT479615	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479614	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT479613	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT479612	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT479611	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT479610	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT479608	hsa-miR-5693	PAR-CLIP	23592263
MIRT479609	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT479607	hsa-miR-3138	PAR-CLIP	23592263
MIRT000157	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000284	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT479631	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031451	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT437792	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT000157	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000157	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25378484
MIRT000157	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25378484
MIRT000408	hsa-let-7c-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25909324
MIRT736685	hsa-miR-483-3p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR	23429262
MIRT479631	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT000284	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT031451	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT437797	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT437792	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT000655	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479630	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT000648	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT479629	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT479628	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT479627	hsa-miR-4323	PAR-CLIP	23592263
MIRT479626	hsa-miR-624-5p	PAR-CLIP	23592263
MIRT479625	hsa-miR-5584-3p	PAR-CLIP	23592263
MIRT162603	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT479624	hsa-miR-4712-5p	PAR-CLIP	23592263
MIRT479623	hsa-miR-770-5p	PAR-CLIP	23592263
MIRT479622	hsa-miR-1281	PAR-CLIP	23592263
MIRT479620	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT479621	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT479619	hsa-miR-668-5p	PAR-CLIP	23592263
MIRT479618	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT479617	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT479616	hsa-miR-4803	PAR-CLIP	23592263
MIRT479615	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479614	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT479613	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT479612	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT479611	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT479610	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT479608	hsa-miR-5693	PAR-CLIP	23592263
MIRT479609	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT479607	hsa-miR-3138	PAR-CLIP	23592263
MIRT054799	hsa-miR-141-3p	Microarray, qRT-PCR	35816043
MIRT000284	hsa-miR-15a-5p	Microarray, qRT-PCR	35816043
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876921	hsa-miR-1226	CLIP-seq
MIRT876922	hsa-miR-1229	CLIP-seq
MIRT876923	hsa-miR-1250	CLIP-seq
MIRT876924	hsa-miR-1262	CLIP-seq
MIRT876925	hsa-miR-1293	CLIP-seq
MIRT876926	hsa-miR-141	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT876930	hsa-miR-1915	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876932	hsa-miR-200a	CLIP-seq
MIRT876933	hsa-miR-21	CLIP-seq
MIRT876934	hsa-miR-2115	CLIP-seq
MIRT876935	hsa-miR-217	CLIP-seq
MIRT876936	hsa-miR-3124-3p	CLIP-seq
MIRT876937	hsa-miR-3158-3p	CLIP-seq
MIRT876938	hsa-miR-3183	CLIP-seq
MIRT876939	hsa-miR-3185	CLIP-seq
MIRT876940	hsa-miR-3187-3p	CLIP-seq
MIRT876941	hsa-miR-3189-3p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT876943	hsa-miR-323-5p	CLIP-seq
MIRT876944	hsa-miR-323b-5p	CLIP-seq
MIRT876945	hsa-miR-33a	CLIP-seq
MIRT876946	hsa-miR-33b	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT876948	hsa-miR-3620	CLIP-seq
MIRT876949	hsa-miR-3667-3p	CLIP-seq
MIRT876950	hsa-miR-3907	CLIP-seq
MIRT876951	hsa-miR-3909	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876953	hsa-miR-4269	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT876955	hsa-miR-4279	CLIP-seq
MIRT876956	hsa-miR-4289	CLIP-seq
MIRT876957	hsa-miR-4310	CLIP-seq
MIRT876958	hsa-miR-4435	CLIP-seq
MIRT876959	hsa-miR-4462	CLIP-seq
MIRT876960	hsa-miR-4474-3p	CLIP-seq
MIRT876961	hsa-miR-4476	CLIP-seq
MIRT876962	hsa-miR-4483	CLIP-seq
MIRT876963	hsa-miR-4514	CLIP-seq
MIRT876964	hsa-miR-4524	CLIP-seq
MIRT876965	hsa-miR-4530	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT876967	hsa-miR-4685-5p	CLIP-seq
MIRT876968	hsa-miR-4692	CLIP-seq
MIRT876969	hsa-miR-4701-3p	CLIP-seq
MIRT876970	hsa-miR-4701-5p	CLIP-seq
MIRT876971	hsa-miR-4723-3p	CLIP-seq
MIRT876972	hsa-miR-4726-3p	CLIP-seq
MIRT876973	hsa-miR-4733-3p	CLIP-seq
MIRT876974	hsa-miR-4742-5p	CLIP-seq
MIRT876975	hsa-miR-4749-3p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT876977	hsa-miR-503	CLIP-seq
MIRT876978	hsa-miR-511	CLIP-seq
MIRT876979	hsa-miR-548s	CLIP-seq
MIRT876980	hsa-miR-588	CLIP-seq
MIRT876981	hsa-miR-590-5p	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT876983	hsa-miR-661	CLIP-seq
MIRT876984	hsa-let-7a	CLIP-seq
MIRT876985	hsa-let-7b	CLIP-seq
MIRT876986	hsa-let-7c	CLIP-seq
MIRT876987	hsa-let-7d	CLIP-seq
MIRT876988	hsa-let-7e	CLIP-seq
MIRT876989	hsa-let-7f	CLIP-seq
MIRT876990	hsa-let-7g	CLIP-seq
MIRT876991	hsa-let-7i	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876992	hsa-miR-106a	CLIP-seq
MIRT876993	hsa-miR-106b	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT876996	hsa-miR-122	CLIP-seq
MIRT876921	hsa-miR-1226	CLIP-seq
MIRT876922	hsa-miR-1229	CLIP-seq
MIRT876997	hsa-miR-1246	CLIP-seq
MIRT876998	hsa-miR-1260	CLIP-seq
MIRT876999	hsa-miR-1260b	CLIP-seq
MIRT877000	hsa-miR-1264	CLIP-seq
MIRT877001	hsa-miR-1305	CLIP-seq
MIRT876926	hsa-miR-141	CLIP-seq
MIRT877002	hsa-miR-142-5p	CLIP-seq
MIRT877003	hsa-miR-146b-3p	CLIP-seq
MIRT877004	hsa-miR-155	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT877005	hsa-miR-17	CLIP-seq
MIRT877006	hsa-miR-188-3p	CLIP-seq
MIRT877007	hsa-miR-193a-5p	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876932	hsa-miR-200a	CLIP-seq
MIRT877008	hsa-miR-203	CLIP-seq
MIRT877009	hsa-miR-20a	CLIP-seq
MIRT877010	hsa-miR-20b	CLIP-seq
MIRT876934	hsa-miR-2115	CLIP-seq
MIRT877011	hsa-miR-3146	CLIP-seq
MIRT877012	hsa-miR-3156-3p	CLIP-seq
MIRT877013	hsa-miR-3156-5p	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877015	hsa-miR-3163	CLIP-seq
MIRT877016	hsa-miR-3173-3p	CLIP-seq
MIRT877017	hsa-miR-3173-5p	CLIP-seq
MIRT876941	hsa-miR-3189-3p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT877018	hsa-miR-320e	CLIP-seq
MIRT876943	hsa-miR-323-5p	CLIP-seq
MIRT877019	hsa-miR-34a	CLIP-seq
MIRT877020	hsa-miR-34c-5p	CLIP-seq
MIRT877021	hsa-miR-3609	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT877022	hsa-miR-3689a-3p	CLIP-seq
MIRT877023	hsa-miR-3689c	CLIP-seq
MIRT877024	hsa-miR-378g	CLIP-seq
MIRT877025	hsa-miR-3925-3p	CLIP-seq
MIRT877026	hsa-miR-3942-3p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT877027	hsa-miR-4268	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT877028	hsa-miR-4292	CLIP-seq
MIRT877029	hsa-miR-4301	CLIP-seq
MIRT877030	hsa-miR-4314	CLIP-seq
MIRT877031	hsa-miR-4428	CLIP-seq
MIRT877032	hsa-miR-4433	CLIP-seq
MIRT877033	hsa-miR-4437	CLIP-seq
MIRT877034	hsa-miR-4448	CLIP-seq
MIRT877035	hsa-miR-4458	CLIP-seq
MIRT877036	hsa-miR-4464	CLIP-seq
MIRT877037	hsa-miR-449b	CLIP-seq
MIRT877038	hsa-miR-4500	CLIP-seq
MIRT877039	hsa-miR-451b	CLIP-seq
MIRT876964	hsa-miR-4524	CLIP-seq
MIRT877040	hsa-miR-4525	CLIP-seq
MIRT877041	hsa-miR-4646-5p	CLIP-seq
MIRT877042	hsa-miR-4648	CLIP-seq
MIRT877043	hsa-miR-4653-3p	CLIP-seq
MIRT877044	hsa-miR-4654	CLIP-seq
MIRT877045	hsa-miR-4670-3p	CLIP-seq
MIRT877046	hsa-miR-4674	CLIP-seq
MIRT877047	hsa-miR-4676-5p	CLIP-seq
MIRT877048	hsa-miR-4695-5p	CLIP-seq
MIRT877049	hsa-miR-4709-5p	CLIP-seq
MIRT877050	hsa-miR-4714-3p	CLIP-seq
MIRT877051	hsa-miR-4716-3p	CLIP-seq
MIRT877052	hsa-miR-4720-3p	CLIP-seq
MIRT877053	hsa-miR-4728-5p	CLIP-seq
MIRT876973	hsa-miR-4733-3p	CLIP-seq
MIRT877054	hsa-miR-4733-5p	CLIP-seq
MIRT877055	hsa-miR-4748	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877057	hsa-miR-4769-5p	CLIP-seq
MIRT877058	hsa-miR-4774-5p	CLIP-seq
MIRT877059	hsa-miR-4793-5p	CLIP-seq
MIRT877060	hsa-miR-4796-3p	CLIP-seq
MIRT877061	hsa-miR-4802-5p	CLIP-seq
MIRT877062	hsa-miR-4804-3p	CLIP-seq
MIRT877063	hsa-miR-485-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT876977	hsa-miR-503	CLIP-seq
MIRT877064	hsa-miR-510	CLIP-seq
MIRT877065	hsa-miR-519d	CLIP-seq
MIRT877066	hsa-miR-541	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877068	hsa-miR-548ah	CLIP-seq
MIRT877069	hsa-miR-574-5p	CLIP-seq
MIRT877070	hsa-miR-575	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT877072	hsa-miR-621	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT877073	hsa-miR-654-5p	CLIP-seq
MIRT877074	hsa-miR-665	CLIP-seq
MIRT877075	hsa-miR-766	CLIP-seq
MIRT877076	hsa-miR-874	CLIP-seq
MIRT877077	hsa-miR-93	CLIP-seq
MIRT877078	hsa-miR-98	CLIP-seq
MIRT876984	hsa-let-7a	CLIP-seq
MIRT876985	hsa-let-7b	CLIP-seq
MIRT876986	hsa-let-7c	CLIP-seq
MIRT876987	hsa-let-7d	CLIP-seq
MIRT876988	hsa-let-7e	CLIP-seq
MIRT876989	hsa-let-7f	CLIP-seq
MIRT876990	hsa-let-7g	CLIP-seq
MIRT876991	hsa-let-7i	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876992	hsa-miR-106a	CLIP-seq
MIRT876993	hsa-miR-106b	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT1959912	hsa-miR-1207-5p	CLIP-seq
MIRT1959913	hsa-miR-1224-3p	CLIP-seq
MIRT877000	hsa-miR-1264	CLIP-seq
MIRT877002	hsa-miR-142-5p	CLIP-seq
MIRT877004	hsa-miR-155	CLIP-seq
MIRT1959914	hsa-miR-1587	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT877005	hsa-miR-17	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT877009	hsa-miR-20a	CLIP-seq
MIRT877010	hsa-miR-20b	CLIP-seq
MIRT1959915	hsa-miR-2682	CLIP-seq
MIRT1959916	hsa-miR-3127-3p	CLIP-seq
MIRT877011	hsa-miR-3146	CLIP-seq
MIRT877015	hsa-miR-3163	CLIP-seq
MIRT877021	hsa-miR-3609	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT1959917	hsa-miR-3616-3p	CLIP-seq
MIRT1959918	hsa-miR-3652	CLIP-seq
MIRT877025	hsa-miR-3925-3p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876957	hsa-miR-4310	CLIP-seq
MIRT1959919	hsa-miR-4423-3p	CLIP-seq
MIRT1959920	hsa-miR-4430	CLIP-seq
MIRT877032	hsa-miR-4433	CLIP-seq
MIRT1959921	hsa-miR-4436b-3p	CLIP-seq
MIRT1959922	hsa-miR-4453	CLIP-seq
MIRT877035	hsa-miR-4458	CLIP-seq
MIRT1959923	hsa-miR-4492	CLIP-seq
MIRT1959924	hsa-miR-4498	CLIP-seq
MIRT1959925	hsa-miR-449c	CLIP-seq
MIRT877038	hsa-miR-4500	CLIP-seq
MIRT1959926	hsa-miR-4505	CLIP-seq
MIRT877040	hsa-miR-4525	CLIP-seq
MIRT876965	hsa-miR-4530	CLIP-seq
MIRT1959927	hsa-miR-4534	CLIP-seq
MIRT1959928	hsa-miR-4538	CLIP-seq
MIRT1959929	hsa-miR-4640-3p	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT877043	hsa-miR-4653-3p	CLIP-seq
MIRT1959930	hsa-miR-4656	CLIP-seq
MIRT877046	hsa-miR-4674	CLIP-seq
MIRT1959931	hsa-miR-4675	CLIP-seq
MIRT877051	hsa-miR-4716-3p	CLIP-seq
MIRT1959932	hsa-miR-4741	CLIP-seq
MIRT1959933	hsa-miR-4753-3p	CLIP-seq
MIRT1959934	hsa-miR-4753-5p	CLIP-seq
MIRT1959935	hsa-miR-4763-3p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877060	hsa-miR-4796-3p	CLIP-seq
MIRT877061	hsa-miR-4802-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT877065	hsa-miR-519d	CLIP-seq
MIRT877068	hsa-miR-548ah	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT1959936	hsa-miR-635	CLIP-seq
MIRT877074	hsa-miR-665	CLIP-seq
MIRT1959937	hsa-miR-762	CLIP-seq
MIRT877075	hsa-miR-766	CLIP-seq
MIRT877077	hsa-miR-93	CLIP-seq
MIRT1959938	hsa-miR-940	CLIP-seq
MIRT877078	hsa-miR-98	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT1959913	hsa-miR-1224-3p	CLIP-seq
MIRT876998	hsa-miR-1260	CLIP-seq
MIRT876999	hsa-miR-1260b	CLIP-seq
MIRT2196895	hsa-miR-1280	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT2196896	hsa-miR-184	CLIP-seq
MIRT2196897	hsa-miR-190	CLIP-seq
MIRT2196898	hsa-miR-190b	CLIP-seq
MIRT876930	hsa-miR-1915	CLIP-seq
MIRT877007	hsa-miR-193a-5p	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876933	hsa-miR-21	CLIP-seq
MIRT876935	hsa-miR-217	CLIP-seq
MIRT2196899	hsa-miR-2278	CLIP-seq
MIRT2196900	hsa-miR-24	CLIP-seq
MIRT877012	hsa-miR-3156-3p	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT2196901	hsa-miR-3160-5p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT876945	hsa-miR-33a	CLIP-seq
MIRT876946	hsa-miR-33b	CLIP-seq
MIRT2196902	hsa-miR-3663-3p	CLIP-seq
MIRT2196903	hsa-miR-3688-5p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876953	hsa-miR-4269	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT876955	hsa-miR-4279	CLIP-seq
MIRT2196904	hsa-miR-4284	CLIP-seq
MIRT876956	hsa-miR-4289	CLIP-seq
MIRT877029	hsa-miR-4301	CLIP-seq
MIRT877030	hsa-miR-4314	CLIP-seq
MIRT2196905	hsa-miR-4318	CLIP-seq
MIRT876959	hsa-miR-4462	CLIP-seq
MIRT876960	hsa-miR-4474-3p	CLIP-seq
MIRT876963	hsa-miR-4514	CLIP-seq
MIRT2196906	hsa-miR-4517	CLIP-seq
MIRT877041	hsa-miR-4646-5p	CLIP-seq
MIRT2196907	hsa-miR-4651	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT877047	hsa-miR-4676-5p	CLIP-seq
MIRT876968	hsa-miR-4692	CLIP-seq
MIRT877052	hsa-miR-4720-3p	CLIP-seq
MIRT876972	hsa-miR-4726-3p	CLIP-seq
MIRT876974	hsa-miR-4742-5p	CLIP-seq
MIRT2196908	hsa-miR-4762-3p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877062	hsa-miR-4804-3p	CLIP-seq
MIRT2196909	hsa-miR-4804-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT2196910	hsa-miR-514	CLIP-seq
MIRT2196911	hsa-miR-514b-3p	CLIP-seq
MIRT877066	hsa-miR-541	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877070	hsa-miR-575	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT876981	hsa-miR-590-5p	CLIP-seq
MIRT2196912	hsa-miR-608	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT877073	hsa-miR-654-5p	CLIP-seq
MIRT876983	hsa-miR-661	CLIP-seq
MIRT2442072	hsa-miR-4445	CLIP-seq
MIRT2442073	hsa-miR-4446-5p	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXM1	Unknown	23240008
HMGA1	Activation	22249617
LIN28A	Unknown	22467868
MSC	Repression	15213307
NANOG	Repression	17761754
NANOG	Unknown	19139263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7667636
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	2188730
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	20360007
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IDA	20360007
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	20360007
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	7644510, 11298456, 15161933, 19289404, 28330616, 32296183, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007077	Process	Mitotic nuclear membrane disassembly	IDA	2188730
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	TAS	11139144
GO:0009314	Process	Response to radiation	IDA	21376736
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	20360007
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	21376736
GO:0045740	Process	Positive regulation of DNA replication	TAS
GO:0051087	Function	Protein-folding chaperone binding	IPI	22843495
GO:0051301	Process	Cell division	IEA
GO:0110032	Process	Positive regulation of G2/MI transition of meiotic cell cycle	IBA
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IEA

Other IDs

• MIM: 116947
• HGNC: 1725
• e!Ensembl: ENSG00000164045

Protein

• UniProt ID: P30304
• Protein name: M-phase inducer phosphatase 1 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25A)
• Protein function: Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression (PubMed:12676925, PubMed:14559997, PubMed:1836978, PubMed:20360007). Directly dephosphorylates CDK1 and stimulates its kinase activity (PubMed:2036
• PDB: 1C25, 8ROZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06617	M-inducer_phosp	86 → 328	M-phase inducer phosphatase	Family
  PF00581	Rhodanese	369 → 476	Rhodanese-like domain	Domain

• Sequence:

  MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
  QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
  RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
  ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
  WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
  ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
  SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
  DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
  CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

• Sequence length: 524

Pathways

KEGG:

Cell cycle
Cellular senescence
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation

Reactome:

Transcription of E2F targets under negative control by DREAM complex
Polo-like kinase mediated events
Activation of ATR in response to replication stress
Ub-specific processing proteases
Cyclin E associated events during G1/S transition
Cyclin A/B1/B2 associated events during G2/M transition
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
Cyclin A:Cdk2-associated events at S phase entry
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant polycystic liver disease	Likely pathogenic	rs3731499	RCV001844878	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC FEVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10573135		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16715141, 29138515		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27384875		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16715141		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22249617		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11106571	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12411323		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17483325		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	22155366		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12960694, 25816175, 30106448, 31115494		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12745652	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29287594	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10995786, 12045150, 16598773, 18566993, 19621387, 20605569, 20614206, 20724916, 21607584, 21670150, 21761201, 30443946, 30443958		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10995786, 20614206, 23730206, 29287594, 34275890, 34990474, 35186236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19457610, 23730206, 36539837	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11304565, 16715141, 17111124, 22843495, 9414655		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23544130, 27644634, 28333141, 36539837	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21291864, 27384875		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35142956	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11487274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10467347, 31281464		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28607169		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31505105		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31505105		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22249617		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27053344		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27053344	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19826040		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24556688		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11304565, 19826040	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17283130		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24993091, 30899377		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33282948	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25816175		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25816175		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37386808	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32468021, 37173384	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25218593		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29544887		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21618027		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21618027		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19948152, 20217459, 27485204, 28651608		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30548945, 39830513	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29624473, 29672635	Associate	★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	12745652		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10754492, 12960694		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	36483920	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24556688		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16854822	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16854822, 26515730, 32024878	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16854822, 26515730		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12738732, 15534860, 18204780, 22705122, 25909324, 26647881, 27644634, 28333141, 31293973		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12738732, 18204780		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15534860		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25990966		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11487274	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10754492, 9563496		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12745652, 32048780	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14767575		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12960694		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12745652, 12960694		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12960694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10995786, 12045150, 16598773, 18566993, 19621387, 20228808, 20605569, 20614206, 20724916, 21607584, 21670150, 21761201, 30443946, 30443958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24993091		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25816175		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25218593		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21291864, 27384875		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10467347, 31281464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19013180		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28951130		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18073536, 19013180, 20228808, 22263797, 22467868, 28951130		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31505105		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19826040		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10995786, 12045150		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16598773		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22249617		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	24724603		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37898408	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10754492, 11304565, 11487274, 16715141, 17111124, 17283130, 19075563, 20614206, 22249617, 26714930, 28004354, 28333141, 28422979, 28951130, 9414655		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11106571	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10445853, 21145615, 23071577, 25990966, 30902389		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31799646		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31799646	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10467347		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31281464		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22843495		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	23675485	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	18949056, 22155366		★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	22155366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30646895		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19013180		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14673957		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17604597	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	25326518		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31237025		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29138515		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11487274, 17111124, 28951130		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30858545		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23675485, 29672635	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29624473	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28951130		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23675485, 28873083, 29624473		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10376964, 27983933, 30106448, 38613794, 9414655	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	12085185	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	12085185	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32766313, 35091678, 36998242	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29246203	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10982822, 31505105, 34761581, 40197384	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30021902		★☆☆☆☆ Found in Text Mining only