Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9921
Gene name	Ring finger protein 10
Gene symbol	RNF10
Synonyms (NCBI Gene)	RIE2
Chromosome	12
Chromosome location	12q24.31
Summary	The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spli

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046718	hsa-miR-222-3p	CLASH	23622248
MIRT044532	hsa-miR-320a	CLASH	23622248
MIRT041789	hsa-miR-484	CLASH	23622248
MIRT038323	hsa-miR-130b-5p	CLASH	23622248
MIRT036845	hsa-miR-877-3p	CLASH	23622248
MIRT439764	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439764	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1309015	hsa-miR-1275	CLIP-seq
MIRT1309016	hsa-miR-15a	CLIP-seq
MIRT1309017	hsa-miR-15b	CLIP-seq
MIRT1309018	hsa-miR-16	CLIP-seq
MIRT1309019	hsa-miR-186	CLIP-seq
MIRT1309020	hsa-miR-195	CLIP-seq
MIRT1309021	hsa-miR-23a	CLIP-seq
MIRT1309022	hsa-miR-23b	CLIP-seq
MIRT1309023	hsa-miR-23c	CLIP-seq
MIRT1309024	hsa-miR-3120-3p	CLIP-seq
MIRT1309025	hsa-miR-3128	CLIP-seq
MIRT1309026	hsa-miR-3148	CLIP-seq
MIRT1309027	hsa-miR-3190	CLIP-seq
MIRT1309028	hsa-miR-320e	CLIP-seq
MIRT1309029	hsa-miR-361-3p	CLIP-seq
MIRT1309030	hsa-miR-424	CLIP-seq
MIRT1309031	hsa-miR-4261	CLIP-seq
MIRT1309032	hsa-miR-4289	CLIP-seq
MIRT1309033	hsa-miR-4422	CLIP-seq
MIRT1309034	hsa-miR-4477a	CLIP-seq
MIRT1309035	hsa-miR-4503	CLIP-seq
MIRT1309036	hsa-miR-4525	CLIP-seq
MIRT1309037	hsa-miR-4640-3p	CLIP-seq
MIRT1309038	hsa-miR-4665-5p	CLIP-seq
MIRT1309039	hsa-miR-4668-5p	CLIP-seq
MIRT1309040	hsa-miR-4723-5p	CLIP-seq
MIRT1309041	hsa-miR-4752	CLIP-seq
MIRT1309042	hsa-miR-497	CLIP-seq
MIRT1309043	hsa-miR-501-3p	CLIP-seq
MIRT1309044	hsa-miR-502-3p	CLIP-seq
MIRT1309045	hsa-miR-545	CLIP-seq
MIRT1309046	hsa-miR-548aa	CLIP-seq
MIRT1309047	hsa-miR-548ac	CLIP-seq
MIRT1309048	hsa-miR-548d-3p	CLIP-seq
MIRT1309049	hsa-miR-548g	CLIP-seq
MIRT1309050	hsa-miR-548p	CLIP-seq
MIRT1309051	hsa-miR-548u	CLIP-seq
MIRT1309052	hsa-miR-548z	CLIP-seq
MIRT1309053	hsa-miR-576-5p	CLIP-seq
MIRT1309054	hsa-miR-592	CLIP-seq
MIRT1309055	hsa-miR-597	CLIP-seq
MIRT1309056	hsa-miR-625	CLIP-seq
MIRT1309057	hsa-miR-875-3p	CLIP-seq
MIRT1309015	hsa-miR-1275	CLIP-seq
MIRT2091724	hsa-miR-1322	CLIP-seq
MIRT1309027	hsa-miR-3190	CLIP-seq
MIRT1309029	hsa-miR-361-3p	CLIP-seq
MIRT1309031	hsa-miR-4261	CLIP-seq
MIRT1309033	hsa-miR-4422	CLIP-seq
MIRT1309036	hsa-miR-4525	CLIP-seq
MIRT1309037	hsa-miR-4640-3p	CLIP-seq
MIRT1309038	hsa-miR-4665-5p	CLIP-seq
MIRT1309039	hsa-miR-4668-5p	CLIP-seq
MIRT1309040	hsa-miR-4723-5p	CLIP-seq
MIRT2091725	hsa-miR-4732-3p	CLIP-seq
MIRT1309041	hsa-miR-4752	CLIP-seq
MIRT1309056	hsa-miR-625	CLIP-seq
MIRT2091726	hsa-miR-665	CLIP-seq
MIRT2091727	hsa-miR-671-5p	CLIP-seq
MIRT1309028	hsa-miR-320e	CLIP-seq
MIRT1309029	hsa-miR-361-3p	CLIP-seq
MIRT1309032	hsa-miR-4289	CLIP-seq
MIRT1309051	hsa-miR-548u	CLIP-seq
MIRT2316251	hsa-miR-581	CLIP-seq
MIRT1309054	hsa-miR-592	CLIP-seq
MIRT1309055	hsa-miR-597	CLIP-seq
MIRT2316252	hsa-miR-599	CLIP-seq
MIRT2316253	hsa-miR-610	CLIP-seq
MIRT2612423	hsa-miR-1227	CLIP-seq
MIRT2612424	hsa-miR-1266	CLIP-seq
MIRT2612425	hsa-miR-1269	CLIP-seq
MIRT2612426	hsa-miR-1269b	CLIP-seq
MIRT2612427	hsa-miR-1288	CLIP-seq
MIRT2091724	hsa-miR-1322	CLIP-seq
MIRT2612428	hsa-miR-221	CLIP-seq
MIRT2612429	hsa-miR-222	CLIP-seq
MIRT2612430	hsa-miR-2278	CLIP-seq
MIRT1309024	hsa-miR-3120-3p	CLIP-seq
MIRT2612431	hsa-miR-3127-5p	CLIP-seq
MIRT2612432	hsa-miR-3158-3p	CLIP-seq
MIRT2612433	hsa-miR-3664-3p	CLIP-seq
MIRT2612434	hsa-miR-371-5p	CLIP-seq
MIRT2612435	hsa-miR-371b-5p	CLIP-seq
MIRT2612436	hsa-miR-3918	CLIP-seq
MIRT2612437	hsa-miR-3940-5p	CLIP-seq
MIRT2612438	hsa-miR-4278	CLIP-seq
MIRT2612439	hsa-miR-4302	CLIP-seq
MIRT2612440	hsa-miR-4314	CLIP-seq
MIRT2612441	hsa-miR-4424	CLIP-seq
MIRT2612442	hsa-miR-4507	CLIP-seq
MIRT2612443	hsa-miR-4515	CLIP-seq
MIRT2612444	hsa-miR-4518	CLIP-seq
MIRT2612445	hsa-miR-4519	CLIP-seq
MIRT2612446	hsa-miR-4529-3p	CLIP-seq
MIRT2612447	hsa-miR-4652-5p	CLIP-seq
MIRT2612448	hsa-miR-4690-5p	CLIP-seq
MIRT2612449	hsa-miR-4740-5p	CLIP-seq
MIRT2612450	hsa-miR-548v	CLIP-seq
MIRT2612451	hsa-miR-570	CLIP-seq
MIRT2612452	hsa-miR-922	CLIP-seq
MIRT2612423	hsa-miR-1227	CLIP-seq
MIRT2612424	hsa-miR-1266	CLIP-seq
MIRT2612425	hsa-miR-1269	CLIP-seq
MIRT2612426	hsa-miR-1269b	CLIP-seq
MIRT2612427	hsa-miR-1288	CLIP-seq
MIRT2091724	hsa-miR-1322	CLIP-seq
MIRT2612428	hsa-miR-221	CLIP-seq
MIRT2612429	hsa-miR-222	CLIP-seq
MIRT2612430	hsa-miR-2278	CLIP-seq
MIRT1309024	hsa-miR-3120-3p	CLIP-seq
MIRT2689788	hsa-miR-3124-3p	CLIP-seq
MIRT2612431	hsa-miR-3127-5p	CLIP-seq
MIRT2612432	hsa-miR-3158-3p	CLIP-seq
MIRT2612433	hsa-miR-3664-3p	CLIP-seq
MIRT2612434	hsa-miR-371-5p	CLIP-seq
MIRT2612435	hsa-miR-371b-5p	CLIP-seq
MIRT2612436	hsa-miR-3918	CLIP-seq
MIRT2612437	hsa-miR-3940-5p	CLIP-seq
MIRT2612438	hsa-miR-4278	CLIP-seq
MIRT2612439	hsa-miR-4302	CLIP-seq
MIRT2612440	hsa-miR-4314	CLIP-seq
MIRT2612441	hsa-miR-4424	CLIP-seq
MIRT2612442	hsa-miR-4507	CLIP-seq
MIRT2612443	hsa-miR-4515	CLIP-seq
MIRT2612444	hsa-miR-4518	CLIP-seq
MIRT2612445	hsa-miR-4519	CLIP-seq
MIRT2612446	hsa-miR-4529-3p	CLIP-seq
MIRT2612447	hsa-miR-4652-5p	CLIP-seq
MIRT2689789	hsa-miR-4667-3p	CLIP-seq
MIRT2612448	hsa-miR-4690-5p	CLIP-seq
MIRT2612449	hsa-miR-4740-5p	CLIP-seq
MIRT2612450	hsa-miR-548v	CLIP-seq
MIRT2612451	hsa-miR-570	CLIP-seq
MIRT2612452	hsa-miR-922	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription cis-regulatory region binding	IBA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16335786, 19549727, 21044950, 32814053, 33961781, 36931259
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	16335786
GO:0005737	Component	Cytoplasm	IEA
GO:0006513	Process	Protein monoubiquitination	IDA	34348161, 34469731
GO:0008270	Function	Zinc ion binding	IEA
GO:0010626	Process	Negative regulation of Schwann cell proliferation	IEA
GO:0010626	Process	Negative regulation of Schwann cell proliferation	ISS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0022626	Component	Cytosolic ribosome	IDA	34348161
GO:0031643	Process	Positive regulation of myelination	IBA
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16335786
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IDA	24105792
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	24105792, 34348161, 34469731
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099147	Component	Extrinsic component of postsynaptic density membrane	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:1990116	Process	Ribosome-associated ubiquitin-dependent protein catabolic process	IDA	34348161, 34469731

MIM	HGNC	e!Ensembl
615998	10055	ENSG00000022840

Q8N5U6

Protein name

E3 ubiquitin-protein ligase RNF10 (EC 2.3.2.27) (RING finger protein 10)

Protein function

E3 ubiquitin-protein ligase that catalyzes monoubiquitination of 40S ribosomal proteins RPS2/us5 and RPS3/us3 in response to ribosome stalling (PubMed:34348161, PubMed:34469731). Part of a ribosome quality control that takes place when ribosomes

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	223 → 267	Ring finger domain	Domain

Sequence

MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGS
KRYNRKRELSYPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVA
EAQRAEFSPAQFSGPKKINLNHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKEL
FLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRC
GHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVATESHQYVVGDTITMQLMKRE
KGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKVALEQQLAEEK
HTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALEQLVLMAPLAKESVFQPRKGV
LEYLSAFDEETTEVCSLDTPSRPLALPLVEEEEAVSEPEPEGLPEACDDLELADDNLKEG
TICTESSQQEPITKSGFTRLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEK
ISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKR
KRQRQKKAREERRRERRIEIEENKKQGKYPEVHIPLENLQQFPAFNSYTCSSDSALGPTS
TEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCVGSLEEDSPFPSFAQMLRVGK
AKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPA
TSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK

Sequence length

811

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30597731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31173254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31173254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24151200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24151200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	31173254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31173254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29723537, 30597731		★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF10 (ring finger protein 10)